KEGG   Anas platyrhynchos (mallard): 101790692Help
Entry
101790692         CDS       T02816                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00230  Purine metabolism
apla01100  Metabolic pathways
apla04270  Vascular smooth muscle contraction
apla04540  Gap junction
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101790692 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101790692 (GUCY1A2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101790692 (GUCY1A2)
Enzymes [BR:apla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101790692 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 101790692
NCBI-ProteinID: XP_027324119
Ensembl: ENSAPLG00000016270
Position
1
AA seq 659 aa AA seqDB search
MSRRKISSESFSSLGSDCPETSPEEEGECPLSRLCWNGSRSPPGPSDPSLAAASISITAA
GSAVSAASAGARRAPRRRRVNLDSLGESIRRLTAPAPQTIRQTLQRTLQYFEHQVIGYRD
AEKNFHNISNRCSYTDCSGNEEAEDVSGILQCTANVLGLKLEEMQEKFGEEFFNVCFDEN
ERVLRAVGGTLQDFFNGFDALLEHIRTSFGRQATLESPSFLCKELPDGNLMLHYFHPHQI
VGFAMMGMIKAAAKKIYRLEVEVEQVANDKLCSEGTNPGNCSCLTFLIKEHENANITKTL
PPGTSQSPLDLRISISTFCRAFPFHLMFDPNMLVLQLGEGLRKQLRCDTHKTLKFQDCFD
IVSPKISATFERVLLRLSTPFVIRTKLEDSGSESKDKVMEIKGQMIHVPESNSILFLGSP
CVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLECTHKALEE
EKKKTVDLLISIFPEEVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISM
LNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHKKSLSHAKAIALMALKMMELSEEVLT
PDGSPIKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQ
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccgcaagatctcctccgagtccttcagctcgctgggctccgactgcccggag
accagccccgaggaggagggcgagtgtcccctgtcccgcctctgctggaacggcagccgc
agcccccccggcccctccgatccgtccctggcagccgcatccatctccatcaccgccgcc
ggctccgccgtctccgcggccagcgccggtgctcgccgcgctcctcgccgccgccgggtc
aacctggactcgctgggcgagagcatccgccgcctgaccgcccccgcgcctcagactatt
cggcaaactcttcaaaggacactgcagtattttgagcatcaagttattggttacagagat
gcagagaagaattttcacaatatatcaaacagatgctcctatacagattgctctggcaat
gaagaagctgaagatgtctcaggaattcttcagtgtacagctaatgtacttggtttgaag
cttgaggaaatgcaagaaaaatttggggaagaattcttcaacgtctgctttgacgagaat
gaaagagttcttcgagcagtaggtgggacccttcaagacttcttcaatggctttgatgct
ttgctggagcacattagaacttcatttggaagacaggccaccctggaatccccttctttc
ctatgcaaagagctccccgatggcaatctcatgcttcattactttcacccacatcaaatt
gtgggatttgcaatgatgggaatgataaaggcagcagcaaagaagatttaccgcttggaa
gtggaagtagaacaggtcgctaatgataagctgtgttcagaggggacgaacccaggtaat
tgcagctgtttgactttccttatcaaagaacatgaaaatgcaaatatcacaaaaacactt
ccaccaggaacttcccagtcccccttagacctgaggattagtatcagcaccttctgcaga
gcattcccctttcacctgatgtttgatccaaacatgcttgttcttcagcttggagaaggt
ctaaggaagcagctcagatgtgacactcataaaactctgaaattccaggactgctttgac
atagtttctcctaagatcagtgccacatttgaacgagtcctcctgagattatctactccc
tttgtcattcgaaccaaacttgaggattctggctctgaaagtaaagacaaggtgatggaa
attaaaggacaaatgattcatgtgccagaatcaaattcaattttgtttctgggatccccc
tgtgtggacaagctggatgaactgatgggccgaggcctccacctttcagacattcctatc
catgatgctactcgcgatgtcatactggttggggagcaagcgaaggcccaagatggcttg
aaaaaacgaatggataagctgaaggcaacactagaatgcacacacaaagccctggaagag
gagaaaaagaaaacagtagatctccttatatctattttccctgaagaagtggctcagcag
ttgtggcaggggcagcaggttcaggccaggaaatttgatgatgtcaccatgctcttttca
gacattgttggcttcactgccatctgcgcacagtgcacacccatgcaggtcatcagcatg
ctgaatgaactctacacacggtttgaccatcagtgtggattcctggacatctacaaggtg
gaaacaataggtgatgcgtactgcgttgcggcagggctccataagaaaagccttagtcat
gctaaagccattgccctgatggcactgaagatgatggagctttcagaagaggtcctcact
ccagatgggagtcctattaagatgaggataggcattcactcaggatcagtgctggccggc
gttgttggtgtaagaatgccacgttattgtctctttggaaacaatgtcacccttgcaagc
aagttcgagtcaggaagtcacccacgccgcatcaatgtcagtccaaccacgtaccagtaa

DBGET integrated database retrieval system