KEGG   Anas platyrhynchos (mallard): 101792176Help
Entry
101792176         CDS       T02816                                 

Gene name
B4GALT4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00533  Glycosaminoglycan biosynthesis - keratan sulfate
apla00601  Glycosphingolipid biosynthesis - lacto and neolacto series
apla01100  Metabolic pathways
Module
apla_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    101792176 (B4GALT4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101792176 (B4GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:apla01003]
    101792176 (B4GALT4)
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     101792176 (B4GALT4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     101792176 (B4GALT4)
    2.4.1.-  
     101792176 (B4GALT4)
Glycosyltransferases [BR:apla01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   101792176 (B4GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C LEAP-2 Phycoerythr_ab
Motif
Other DBs
NCBI-GeneID: 101792176
NCBI-ProteinID: XP_005017322
Ensembl: ENSAPLG00000009388
UniProt: R0K065
Position
1
AA seq 355 aa AA seqDB search
MALNLYVFHIFYKFKVLLLIMLCLMVLWATFSYFVDSGQSMPRPKNTVEDFRKATSLQEE
GNSWKDEKTKLTAAVPATTSPQGHCPALSPYLRGASKLTFKPSLTLEEVQKENPQVARGR
YHPTECSALQRVAILIPHRNRERHLLYLLEHLHPFLQRQQLDYGIYVIHQAGNTKFNRAK
LLNVGYLEALKEENWDCFIFHDVDLVPENDFNIYMCDRQPKHLVVGRNSTGYRLRYQGYF
GGVTALTREQFSKVNGFSNNYWGWGGEDDDLRIRVEMQKMRVVRPSADVARYTMIFHNRD
HGNEENRERMKLLRQVSKMWKTDGLNSCSYKLLSVEHNPLYINITVDFSIQPKIS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccttgaacttgtatgtctttcacatcttctataaattcaaagtgctgctgctcatc
atgctgtgtctgatggtgctatgggccacgttcagttactttgtggactctggacagtca
atgcctagacctaagaacacggtggaggatttcagaaaggcaaccagcctgcaggaggaa
ggcaacagttggaaggacgagaagacaaaattaactgcagcagttcctgccacaacatca
cctcagggtcactgtccagctctgtctccatacctgcgaggtgccagcaagctgaccttc
aaaccctctctcaccctagaagaagtgcaaaaggagaaccctcaggtggccaggggccgg
tatcatcccaccgagtgctcagcgctgcagcgcgtggccattctcatcccacaccgcaat
cgggagaggcacctgctgtacctcctggagcacctccaccccttcctgcagaggcagcag
ctggactatggcatctacgttattcaccaggctggcaacaccaaatttaatcgagctaaa
ctgctgaatgtaggatacctagaggccctgaaagaagagaactgggactgtttcattttc
catgatgtggatctggtgccggagaatgactttaacatttacatgtgtgacagacagcca
aagcaccttgtagttggcaggaacagtactggatacaggttacgttaccagggctatttt
ggaggtgtaactgctctaacaagagaacagttttccaaggtgaatggattctctaacaac
tactggggttggggtggagaagatgatgaccttcgaatcagggttgagatgcagaagatg
cgagtggtgaggccatccgctgatgtagccaggtacacgatgatcttccacaaccgagac
cacggcaatgaggagaacagagagaggatgaagcttctacgccaggtatctaaaatgtgg
aagacagatgggttgaactcctgttcatacaaactgctgtcagtggaacacaaccctttg
tacatcaacatcacagtggatttcagcatacagccaaagatctcgtaa

DBGET integrated database retrieval system