KEGG   Anas platyrhynchos (mallard): 101792880
Entry
101792880         CDS       T02816                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101792880 (AHRR)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101792880 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 Herpes_U5 PAS_4
Other DBs
NCBI-GeneID: 101792880
NCBI-ProteinID: XP_027306012
Position
2
AA seq 783 aa
MESMYLPCLSGIEQLIVYMTTSQSLVVLPGGKTGNRKCDSLLHHRRPAAGNEKSNPSKRH
RDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQAGQTI
KEDNVCNKTAVQEGGLLLESLNGFALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDY
IHVDDRQDFCRQLHWAMNPPQMLSGQQTQTETGEEYILSKLFKAQENDSTTTDYSSFLTR
CFICRVRCLLDSTSGFLTMQFQGKLKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSMT
EMKMKSLLVKAKHKADEAAAVNANSSSKGNSVLCEAAELYGRNSHHEGASFNNVLQIAEN
QLKAKNNGENGISLVKVQANEDHWVWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKIP
SSFASLKGNLDGFSYNSAIETLGQLKHLNWTAVKNEQDNIKVKFEPHTNGECFMQEESLS
SNVSVLGVQNNCTTNNSWTLRNSGSCSMNQRMNVCSNRRAGSFYNRDQSFLNLASTCPSH
WGSAENCQAYSGLQQRAVESYATDHLKLQRSLLSSEPLYDAAFPLDMPIKTEYDSDSENI
ADNYLTSQNRAWMDDNGAARKQLFSYPNRVHLKTEPDLCQQASPCQKPRHCLYTPHNWQC
IVANHPSNLNLNRACKGLRNREVAPFCPQNSSTCLESLPDLPHSECYGQFYSPGPGEEKE
QSNEFFKMPCEYKNPCLVQAIKREPLDSPPLSSSGQNRAHVSFPENTLAGPVPHKPTECT
FLQ
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggaatccatgtatttgccatgcctctctggcatagagcagttgatagtttatatgaca
acatctcagtccctggtggtactacctggaggtaaaacaggtaatcgaaaatgtgattct
cttctccaccacagaaggcctgcagctgggaatgaaaaatcaaatccttcaaagaggcac
agggaccgtctgaatgcagaacttgaccatctggccagcctcctgcctttcccccctgac
ataatatccaagctggacaaactgtccgtgttgcgccttagcgtcagctatctacgagtc
aaaagtttctttcaagccattcaagaaaagcactttaagaagcaagctggccaaacgata
aaagaagacaatgtatgtaacaagaccgctgtacaagaaggtggacttctactagaatca
ctgaatggttttgcactggtggtgagtgcagatggaatgatattttatgcatcatcaaca
attgtggactacctagggtttcatcagactgatgtaatgcaccaaaacatatatgattac
attcatgtggatgatcgtcaggacttctgtagacaactgcactgggccatgaatcctccc
cagatgttgtctggacagcaaacacagacagaaacaggagaagaatatattctcagtaaa
ttgtttaaagcacaagagaatgacagcacgacaacagattattcttccttcttaactcgt
tgtttcatctgtcgagttcgctgcttgttggacagtacttctggcttccttacaatgcag
tttcaaggcaaactaaagtttctttttggacaaaggaagaagtcctcatcaggaacagta
ttaccacctcagctgtccttattctgcatagtggtaccacttcttctcccttctatgaca
gagatgaagatgaaaagcctgcttgtgaaagcaaaacacaaagctgatgaagcagcagca
gtgaatgcaaactccagttctaaaggtaattcagttctgtgtgaagcagcagaattatat
ggaagaaatagtcatcatgaaggtgcatctttcaataatgttttacagattgccgaaaac
caactcaaagcaaagaataatggagaaaatggcatttctctagtcaaagtacaagcaaat
gaagatcactgggtctgggttcaagctaacactcaacttctgtatcgaagtggttgttca
gaatatgtccttgcccagcagcaaatgttaaaggaagaagatgaacaactgaagatacca
agcagttttgccagtttgaaaggaaacctggacggattttcctataacagtgccattgaa
accctgggccagttaaagcatcttaactggacagcagtaaaaaatgaacaagacaatata
aaagtgaagtttgagcctcatacaaacggtgagtgtttcatgcaagaggaatctctcagc
tccaatgtatcagttttaggcgttcaaaacaactgcaccacaaacaacagctggacttta
agaaactcaggctcttgttctatgaaccagcgaatgaatgtgtgttcaaacaggagagct
gggtcattctacaacagagaccaaagtttcttaaatttagcatcaacttgtccttcccac
tgggggagtgcagaaaattgtcaggcttactcaggcttacagcagcgcgctgtggagagc
tacgctacagaccacctgaaactgcagagatcgttactatcctcagagcctctctatgat
gcagcgtttcccttggatatgcctatcaaaacagaatacgattctgattcggaaaacatc
gctgataactacctgacgtcgcaaaaccgagcctggatggacgacaacggcgcagcaagg
aagcagctgttcagctatcccaacagggtgcaccttaaaacagaaccggacctctgtcag
caagcgtcaccttgccagaagccgaggcactgcctttacacgccgcataactggcaatgc
atcgtagcaaatcatcccagcaacctcaatctgaacagagcttgcaagggtttgcgtaac
agagaggtggccccgttttgcccccagaactcctccacctgcttggaaagcctgcctgac
ctgcctcactccgagtgctacggccagttctacagccccggtccaggggaggagaaagag
cagagtaatgagttttttaaaatgccatgtgaatataaaaacccctgcttggttcaagca
atcaagcgtgagcccctggattccccaccgttgtccagcagtggacagaacagagcacat
gtgagcttccctgaaaacacattagcaggtcctgtgcctcataaacccactgaatgtaca
ttcttacaatag

DBGET integrated database retrieval system