KEGG   Anas platyrhynchos (mallard): 101793075Help
Entry
101793075         CDS       T02816                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101793075 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    101793075 (MAP4K4)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101793075 (MAP4K4)
Protein kinases [BR:apla01001]
 Serine/threonine kinases: STE group
  STE20 family
   101793075 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101793075
NCBI-ProteinID: XP_027301590
Ensembl: ENSAPLG00000003218
Position
1
AA seq 1392 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEEMERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRQQQQQQQQQQ
QQQQQQQQQQQQERNKQSYHTPEPKPHYEPAERAREVEERFRKTNQGSPEAQSKQMGKVL
EPPVPSRSESFSNGNSEPAQPALQRPMEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFA
HHHLRSQDPYPPSRSEVLNQSSDSKSEVPDPTQKAWARSDSDEVPPRVPVRTTSRSPVLS
RRDSPLQGSGQQNNQAGQRNSTSNIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHP
GSQSGSGERFRMRSSSKSEGSPSQRHESAPKKPEEKKEVFRPIKPAGEVDLTALAKELRA
VEDVRPPHKVTDYSSSSEESGTTDEEDDDMEQEGADESTSGPDDVRAVSTLNLSNGETES
VKTMIVHDDVESEPALTPSKEGTLIVRQSTVDKKRASHHESNGFAGRIHLLPDLLQQSHS
SSTSSTSSSPSSSQPTPTMSPQTPQDKLTTNETQSASNTLQKHKSSSSFTPFIDPRLLQI
SPSSGTTVTSVVGFSSEAMRSEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNS
EILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKN
KLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEV
YAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDI
YLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAY
IRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVY
FMTLGRTSLLSW
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgattctcctgcgaaaagtctggtggatatcgacctgtcctccctgcgggac
cccgccgggattttcgagctggtggaagtggttggcaatggcacgtacgggcaagtctac
aagggtcgacatgtcaagacgggtcagctggcagccatcaaagtcatggacgtgactgag
gatgaagaagaagaaatcaaactggagattaatatgctaaagaagtattctcatcacaga
aatattgcaacttattatggtgctttcattaagaaaagtcctccaggacatgatgaccaa
ctgtggcttgttatggagttttgtggagcaggctctatcacagacctcgtgaagaacacg
aaagggaatactctgaaagaagactggatagcgtacatctccagggagattctcaggggg
ttggcacatcttcatgcccaccatgtgattcacagggatatcaaagggcagaacgtgttg
ttaacagagaacgcagaagtgaaacttgtggattttggtgtgagtgctcagctggacagg
acagttggcaggagaaacactttcattggaactccgtactggatggctccagaagttatt
gcctgtgatgaaaatccagatgctacatacgattacagaagcgacctctggtcttgcggc
attacagccatcgagatggcagaaggagctcccccgctttgtgacatgcatcccatgagg
gcgctctttctgatacccagaaaccctcccccacggttaaaatccaagaaatggtcaaaa
aagtttttcagctttatagaaggctgtctagtgaagaattacatgcagagaccttctaca
gaacaactgttgaaacatccgtttatacgtgaccaaccaaatgaaaggcaagttcgaatc
cagcttaaggaccatatagacaggaccaggaagaagagaggagaaaaagatgagacggag
tatgaatatagtggaagtgaggaagaagaggaggaagtgcctgaacaagaaggagagcca
agttccattgtcaatgtgcctggagaatcaaccctccgacgtgatttcctgaggctgcag
caggaaaacaaggaacggtccgaggcccttcggaggcagcagctgctgcaggagcagcag
ctccgtgagcaggaggagtacaagaggcagctgctggcagagaggcagaaacgcatcgag
cagcaaaaggagcaaaggagacggctggaagagcaacaaagaagagaacgggaagctcgg
aggcaacaggagcgtgagcaaaggcggagggaacaggaagaaaaaagacgtctggaagaa
atggagaggagacgtaaggaggaggaagagagaagaagagcagaggaggaaaagaggagg
gtagaaagggagcaggagtatatcaggcgacagctagaagaggagcagcggcacttggaa
attctacagcagcagctgctccaggagcaggccatgttactggaatacagatggcgagag
atggaggagcatcgacaggcagagcgactccagcgccagttgcagcaggagcaagcctac
ctcctgtcgctgcagcacgatcacaggaggcagcagcagcagcaacagcagcagcagcaa
caacagcagcagcagcagcagcaacagcagcagcaagaaagaaataagcaaagctatcat
acccctgagccaaaaccccactatgagcctgctgaaagagcgcgtgaggtggaggagaga
tttagaaaaacgaatcagggctcccctgaagcacagtcaaagcagatgggcaaagtgttg
gagccaccagtgccttcaagatcagagtccttttccaatggaaactcagaacctgctcag
cctgccctgcagaggccaatggagccccaagtacagtggtcccatctggcatctctcaag
aacaatgtttcccctgtctcgcgatcccattccttcagtgacccttctcccaaatttgct
catcaccatcttcgttcccaggacccatatccaccttcacgcagtgaagtgctaaatcag
agttctgactctaagtcggaggtacccgaccccacccaaaaggcttgggctagatcagac
agtgacgaggtgcctccaagggtacctgtgagaacaacgtcccgatcaccagtcctgtct
cgtcgtgattctccactgcagggcagtgggcagcaaaataaccaagcaggtcaaagaaac
tccacgagcaatatagagcctcgtctgctgtgggaaagggtggagaagctcgtaccaagg
ccaggcagtggcagctcttcgggttcaagcaactctggctcccagcctggctctcacccc
ggctctcagagtgggtctggagagcggttccggatgagatcatcatccaaatcagagggt
tcgccatcacagcgtcatgaaagtgcacctaaaaagcctgaagagaaaaaggaagtcttc
agacctatcaagcctgctggagaagtggatttaactgcattggcaaaggaattgcgagca
gtagaggatgtgcggcctccacataaggtgacggattattcgtcctcaagtgaggagtca
gggacaacggatgaggaagatgatgatatggaacaagaaggagcagatgaatctacttct
ggaccagacgatgtccgagcagtgtcaacactgaacttgagcaatggtgaaacagagtca
gtgaaaaccatgatcgtccacgacgatgtagagagcgaacctgccttgactccttctaag
gagggcaccttaattgtccgacagagtacagttgacaaaaagcgtgccagccatcatgag
agcaatggctttgccggtcgcattcacctcttgccagatctcttacagcaaagccattcc
tcctccacttcctccacctcctcctccccatcctccagccagccgacacccaccatgtcc
ccacagacaccccaggacaagctaactactaatgagactcagtccgctagtaacacactc
cagaaacacaaatcttcctcctcctttacaccttttatagaccccagattactacagatt
tctccatctagtgggacaactgtgacttctgtggtaggattttctagtgaagcaatgaga
tcagaggcaataaggcaagacccaacgcggaaaggatcagttgtcaatgtgaatcctaca
aatacgcgaccacagagcgataccccagagattcgcaaatacaagaagagattcaattct
gagatactgtgcgctgccttatggggagtgaacttgttagtgggcactgaaagtggtctg
atgctgctagacagaagtggtcaggggaaggtttatccgctcatcaatcgaagaagattc
cagcaaatggatgtacttgaagggctgaatgtcttggtgacaatttctggtaagaagaac
aagttgcgagtgtactatttgtcctggttaagaaataaaatccttcacaatgatcccgaa
gttgagaagaaacagggttggacgacggtgggcgacttggaaggctgtgtgcactataaa
gttgtaaaatatgaaagaatcaaattcttggtaattgcattgaagagttctgtggaagtc
tatgcatgggcaccaaagccataccacaaatttatggcctttaagtcatttggggaattg
gtacataagccattgctggtggatctaacagtagaagaaggtcagagactaaaagtgatc
tatggctcctgtgctggcttccatgccgttgatgtggattcgggatcagtctatgacatt
tatctaccaacacatatccagagcagtatccaacctcatgcaatcataattctcccgaat
acggatggaatggagctactggtctgctatgaggatgaaggagtttatgtaaacacatat
ggaaggatcaccaaggacgtggttctgcagtggggagagatgccaacttcagttgcgtat
attcgatccaatcagattatgggctggggagaaaaagcgatcgaaatacgatcagtggaa
actggacacttggacggtgtgttcatgcacaaaagggcacagagactcaagttcttatgt
gaacgcaacgacaaggtcttctttgcctccgtgcggtcaggtggaagcagtcaagtctat
ttcatgacccttggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system