KEGG   Anas platyrhynchos (mallard): 101793121
Entry
101793121         CDS       T02816                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X1
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101793121 (ARNT)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101793121 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4 DUF3067 HAUS2
Other DBs
NCBI-GeneID: 101793121
NCBI-ProteinID: XP_027300350
Ensembl: ENSAPLG00000013397
Position
26
AA seq 807 aa
MAATAANPEMASDVSSLNAAVSSGNPGPGAQAGGAIVQRANKRRPGLDFDDDGEGNSKFL
RCDDDPMPNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVGKLREQLSTSENALTEGTKPWC
LSNKDPAAPPENASKGRILDLKTGTVKKEGQQSMRMCMGSRRSFICRMRCGNGSVDPVSV
NRLSFMRNRCRNGLGAAKDGEPHYVVVHCTGYIKAWPPAGVSLPDDDPDAGQGSKFCLVA
IGRLQVTSSPNCTDMNNVCQPTEFISRHNTEGIFTFIDHRCVATVGYQPQELLGKDIVDF
CHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIIC
TNTNVKNSSQESRPALSNSMQRPQLGQSVSLPLEMGTAQLPSRQQQPPQQTELEVVPGRE
SLSGYDHSQVPVQPVTAAGPEHSKPLEKAESLFSQERDPRFSEIYSNINTDQNKAIPAST
VPANQPIFPQGNTFTPSRPAENFRSSSMVPPVNIIQQQPSSAGRILAQISRHSNPAQVSG
TNWAPGTRPPFTPQQVASQTVKTRPPSFSMGTFQGTPSSFSPMTAPGTTASPSGTAYPNL
ASRGTGFTTEAAQTPTPFQTRATEGVGMWPQWQGQHHGPPSGEQHVQQPQPSQPEVFSDM
LTMLGDQGPNYNNEEFPELNIFPSFSE
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggccgccaccgccgccaacccggaaatggcatcagatgtttcctcgctgaatgcagct
gtcagctctgggaaccctggcccaggtgcacaagctggaggagccatcgttcagagagcc
aacaagaggcgtcctgggcttgattttgatgatgatggagaagggaacagtaaattcctc
aggtgtgatgatgacccaatgccaaatgataaggaaagatttgccaggtctgatgatgaa
cagagttcagcggataaggagagacttgccagggaaaatcacagcgagattgaacgtagg
cgaaggaacaagatgactgcctacatcacagagctgtcagatatggtgcctacctgcagt
gccctggcccgtaaaccagacaagcttaccatcttgcgcatggctgtctctcacatgaag
tccctgcgtggcacaggcaatacctccactgatggcacctacaaaccctcctttctcact
gatcaggaactcaaacacctgatcctagaggcagccgacggctttctgttcatagtgtcc
tgtgagactgggagggtggtgtatgtctctgattctgtgactcctgtcctgaaccagccc
caatctgaatggtttggcagcaccctatacgaccaggtgcacccagatgacgtgggcaag
ctgagggagcagctttccacatcagagaatgcactgacagaaggaaccaaaccctggtgc
ctttctaacaaggatcctgcagccccccctgagaatgcatctaaaggtcgcatcctagat
ttaaagacaggtactgtcaagaaggaaggccagcagtccatgagaatgtgcatgggttca
cgaagatcttttatctgccgaatgaggtgtggcaacggctcagtggatccagtttctgta
aatcgtctcagctttatgaggaatcgctgcaggaatggcttaggtgcagcaaaagatggt
gaacctcactacgttgtggtgcactgcacaggttacataaaagcctggccccctgcaggt
gtttcactgcctgatgatgacccggatgctggccagggcagcaagttttgcctcgtggct
attggcagactccaggtcactagctcgcccaactgtacagacatgaacaatgtttgtcag
ccaacagagttcatctcccgacacaacactgaaggcattttcaccttcatagatcaccgc
tgtgtggctactgttggctaccagccacaggaacttctggggaaagacattgtggatttc
tgccacccagaagaccaacagcttttgcgggacagctttcagcaggtggtgaagttaaaa
ggccaggttctgtcagtcatgttccgattccgatccaaaaaccgggaatggctctggatg
agaaccagctcctttaccttccagaacccctactcggatgaaattgagtacatcatctgt
accaacaccaacgtcaagaactcaagccaggaatctcggcctgccctttcaaactctatg
cagaggccccagctggggcagagcgtcagtcttcccctggagatgggcacagcacagctg
ccctcaaggcagcagcagccgccacaacagacagagttggaggtggtcccaggaagagag
agtctgtctggttacgaccactcacaggttcctgttcagcctgtgactgctgctggccca
gaacacagcaagccattggagaaagcagagagcctgtttagtcaggagagggacccaagg
ttcagtgaaatctacagcaatatcaatacagaccagaacaaagccattcctgccagcaca
gtccctgccaaccagcccatctttccacagggaaacacttttactccatcacggcctgcc
gagaacttcaggagcagcagcatggtacctccagtgaacattattcagcaacagccctca
tcagcaggccggatcttagcacagatttcacgccactccaaccctgctcaggtcagcgga
accaactgggctccggggactcggccaccattcacaccccagcaagtggcatcccaaaca
gtgaagactcggcccccttcattcagcatggggactttccaaggcaccccatcctcattc
agcccaatgacagcacctggcactaccgcttcccccagtggcactgcttacccaaacctt
gccagccgtggtactggcttcacaacagaggcagcgcagacccccactccattccagaca
cgggcaacagaaggtgtgggaatgtggccgcagtggcaaggacagcaccatggcccgccg
tctggggagcagcacgtgcagcagccgcagccaagtcagcctgaggtcttctcagacatg
ctgacaatgctgggagaccaaggacccaactacaacaatgaagagttcccagaattgaat
atattcccttctttttcagaataa

DBGET integrated database retrieval system