KEGG   Anas platyrhynchos (mallard): 101793247
Entry
101793247         CDS       T02816                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia-inducible factor 1-alpha isoform X1
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04137  Mitophagy - animal
apla04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:apla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101793247 (HIF1A)
   04137 Mitophagy - animal
    101793247 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101793247 (HIF1A)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101793247 (HIF1A)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD PAS HIF-1 PAS_9 PAS_4 HLH
Other DBs
NCBI-GeneID: 101793247
NCBI-ProteinID: XP_005030000
Ensembl: ENSAPLG00000002715
Position
5
AA seq 836 aa
MSSTGAALTSATGARVAAAGGLCLKAAGLALACCERLLISSERRKEKSRDAARCRRSKES
EVFYELAHQLPLPHTVSAHLDKASIMRLTISYLRMRKLLDAGELETEAKMEKELNCFYLK
ALDGFVMVLSEDGDMIYMSENVNKCMGLTQFELTGHSVFDFTHPCDHEELREMLTHRNGP
VKKGKEQNTERSFFLRMKCTLTSRGRTVNIKSATWKVLHCTGHIRVYDTCSNQTHCGYKK
PPMTCLVLICEPIPHPSNIEVPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRS
IYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKQGGYVWVETQATVIYNTKNSQPQC
IVCVNYVLSGIVQKDLIFSLGQTECMLKPVESPDMKMTKIFNKDDLDDTNNLFEKLKQEP
DALTVLAPAAGDTIISLDFSSNESDEQRDEVPLYNDVMLPSSSEKLQNINMAMSPLPASE
TTKPLRSNADPALNREVVSKLEPNTETLELSFTMPQVQEQPTSPSDASTSQSSPEPSSPN
DYCFDVDNDMANEFKLELVEKLFAIDTEAKNPFSTQETDLDLEMLAPYIPMDDDFQLRSF
DQLSPLESSSSSSQNAATITIFQQTQTPSTTADEIKPVAERVDDVKTLIVPSSPVHIIND
TSSAPASPYGGNRSRTASPIRTGKGTLDQTEKPCPGTPSLLTVTLNKRSTAMDEELNPKM
LALHNAQRKRKMEHDGSLFQAVGIGSLFQQTGDRGGNASLAWKRVKACKTTGHNGVEQKT
IILLSTDIASKLLGQSMDESGLPQLTSYDCEVNAPIQGNRNLLQGEELLRALDQVN
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgtcgagtacgggggctgcgttgacatctgcaactggtgcacgtgtggctgctgctggt
gggctctgcctgaaggctgctggactggctcttgcttgctgtgaaaggctgctgattagt
tctgaacgcaggaaagaaaaatcaagagatgcagctcgatgtcgaagaagcaaggagtcg
gaagtgttctacgaacttgctcatcagctgcctcttccgcacacggtgagcgcccacctt
gacaaggcctccatcatgaggttgaccatcagctacttgcgcatgaggaagctgctggat
gctggtgagctggagacagaagccaaaatggagaaggaactgaactgtttctacctgaaa
gctcttgatggatttgtcatggttctctctgaagatggggacatgatttacatgtctgaa
aatgtgaacaagtgtatgggactcactcagtttgagttgacggggcacagtgtatttgat
ttcactcatccatgtgaccatgaagagctgagagaaatgcttacgcacagaaatggtcct
gtgaaaaagggcaaagaacaaaacacggagcgcagcttttttctcagaatgaagtgcaca
ctgaccagcaggggaagaacagtgaatataaagtctgctacgtggaaggtactgcactgc
accgggcacatccgtgtgtacgacacgtgcagtaatcaaactcactgtggctacaagaag
cctcccatgacgtgcttggtgttgatatgtgaacctattcctcacccatccaacattgag
gtcccactggacagtaaaacgttcctcagtcgtcacagtctcgatatgaagttttcctat
tgtgatgaaagaattacagagctgatgggatatgagccagaggaactcctgggtcgttcc
atctatgagtactaccatgcgctggattctgatcatctgaccaaaacgcaccatgatatg
ttcacaaaagggcaggtgacaacagggcagtacagaatgcttgctaaacaaggtggctat
gtctgggttgaaactcaagcaactgttatatacaacactaagaattctcagccacagtgc
atagtatgtgtaaactatgtgttgagtggaattgttcagaaggacttgatattttccctt
ggacaaactgagtgtatgctgaaaccagtggagtctccagatatgaaaatgaccaaaata
ttcaacaaagatgacctggatgataccaacaacctttttgaaaaacttaaacaggaacca
gatgctttaactgtgctggctccagctgctggagacacaattatctctctagatttcagc
agtaatgagtctgatgaacaacgtgatgaagttcctttgtataacgatgtaatgctcccc
tcatccagtgagaaattgcagaatataaatatggcaatgtccccactacctgcctctgaa
actacaaagccacttcgtagcaatgctgatcctgcactcaatagagaagttgtatcaaag
ctggagccaaacacagagacactcgaactttcttttaccatgcctcaggtgcaagagcag
ccaaccagcccttctgatgcaagtaccagccaaagttcacctgagcccagtagtcccaat
gactattgctttgatgtggataatgatatggctaatgagttcaaactggaattagtggag
aaactctttgcgatagatacagaagcaaaaaatccattctctactcaggaaactgattta
gacttggagatgttggctccttacatcccgatggatgatgacttccagctacgctccttt
gatcagctatctccactggaaagcagttcttccagctcccaaaacgcagccactattacc
atatttcagcagactcagacaccatcaactactgctgatgaaataaaaccagtggcagaa
cgtgtggatgatgtgaagacgctaattgttccttcatctcctgtccacataatcaatgac
acgagtagtgccccagcgtcaccttacggtgggaacaggagtcgaactgcatctccaatc
agaacaggaaaaggaacattggatcagacagaaaaaccttgtccaggaacacccagtttg
ctaacagtcactctgaataaaagatctactgcaatggatgaagaactaaatccaaagatg
ctagctttgcataatgctcagagaaaacgaaaaatggaacatgatggttcactttttcag
gcagttggaattgggtctttattccagcagacaggtgaccgtggaggaaatgcatcgctt
gcttggaaacgtgtaaaggcatgcaaaacaactggtcataatggagtggagcaaaagaca
atcattctattatcaactgacatagcaagtaaacttctagggcagtcgatggatgaaagt
ggactaccccaactcacaagttatgattgtgaagtaaatgctcccatacaaggcaacaga
aacctgctacagggggaagaactgctcagagctctggatcaagttaactga

DBGET integrated database retrieval system