KEGG   Anas platyrhynchos (mallard): 101793295
Entry
101793295         CDS       T02816                                 

Gene name
MECOM
Definition
(RefSeq) LOW QUALITY PROTEIN: MDS1 and EVI1 complex locus protein
  KO
K04462  ecotropic virus integration site 1 protein
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101793295 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101793295 (MECOM)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101793295 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-BED PyrI_C zf-C2H2_8
Other DBs
NCBI-GeneID: 101793295
NCBI-ProteinID: XP_027320339
Ensembl: ENSAPLG00000012134
Position
9
AA seq 1223 aa
MRSKGRARKLAASDECLYESFPELPLEEGPDADGEAANAQCPTSVSIQEPSSPATSSEAF
TPKESSPYKAPIYIPDDIPIPSEFELRESNIPGAGLGIWTKRKIEAGEKFGPFVGEQRPH
LKDPSYGWEILDEFCNVKFCIDASQPDVGNWLKYIKFAGCYNQHNLVACQISDQIFYRVV
ADIEPGEELLLFMKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPH
SAFSMVEEDFQKKLENENDLQDVHEIQECKECDQVFPDLQRRVLAVVLRYLSRQMLGQIL
CCDETEEYVVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFI
CEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGG
FFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPS
GLYHRPPLLPTSSPVKGLPSADQTNKSQSPLMTSPQILPATQDILKALNKQPSVGENKPV
ELQPERSSEERPHEKLSDQSESSDLDDVSTPSGSDLETTSGSDLESDIESEKEKFKENGK
MFKDKVSSLQSLASINNKKDHSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTG
LVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQSPSELKKIPKGS
SESPFDLTTKRKEEKPVTPIPSKPAAPPAASQDQPLDLSMGSRSRASGTKQAEPRKNHVF
GEKKGGDLEQRKASESSLQHARPTPFFMDPIYRVEKRKLTDPLEAXKEKYLRPSPGFLFH
PQFQLPDQRIWMSAIENMAEKLESFSALKPEANELIQSVPSMFNFRAPPSALPETLLRKG
KERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKP
FKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRN
FIGNSNHNNQSPRNSEERMNGSHFKDEKAMVTSQNSDLLDDEEAEDEVMMDEEDEESEIA
GKAVKEPATSDIHEGTPEEDYEETSTLDMNCKASPGRYKEEEYSKTGLSALDHIRHFTDS
LKMRKMEENQYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDKDSLHSASHNS
PNMWHSMARAAAESSAIQSISHV
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgcgatccaaaggcagggcgaggaagctggccgcaagtgatgaatgtctgtatgaaagc
tttcccgagcttcccttggaggaagggccagacgctgatggcgaggccgcgaacgcccag
tgtccgacgtccgtcagcattcaggagccctcatctccagcaacctccagcgaagccttc
acgccaaaggagagctctccttacaaggctccgatatacattcccgatgacattcccatt
ccttcagagttcgaactccgagaatccaacattcctggagcgggattagggatatggacc
aaaaggaagatcgaagctggcgaaaagttcggccctttcgtgggagagcagcggccacac
cttaaagatcccagttacggttgggagatcttggatgagttttgcaatgtgaagttctgc
atagatgccagtcaaccagatgtaggaaactggctcaaatatatcaagtttgctggatgc
tacaatcagcacaaccttgttgcatgtcagataagtgatcagatattctacagagttgta
gcagacattgaacctggagaggagctgctactgttcatgaagagtgaagattattcacat
gaaacaatggctccggacattcacgaggagcgccagtatcgctgcgaggactgcgaccag
ctctttgagtccaaggctgagcttgtagaccaccagaagttcccctgcagcacacctcac
tccgcgttctccatggtggaggaggacttccagaaaaagcttgagaatgagaacgacctt
caggatgtgcatgaaatccaggagtgtaaagagtgtgatcaagtcttcccagatttgcaa
aggagggttctagcagttgtgctgaggtatctcagcaggcagatgctgggtcagatcctc
tgctgtgatgagacagaagaatatgtcgttttcacggaccccagcaacctccagaggcac
attcgttcccagcatgttggggctcgtgctcacgcttgtccagagtgtggcaaaacgttt
gccacttcttcaggcctcaaacagcataaacacatccacagcagtgtcaaaccttttata
tgtgaggtctgccataaatcctatactcagttttcaaacctttgtcgacataagcgcatg
catgctgattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacg
tcttccttaaataaacacaggagattttgtgagggcaagaaccattttgcagcaggagga
ttttttggccaaggcatttcacttcctggaaccccagctatggataaaacgtccatggtt
aatatgaatcatgcaaatccgggccttgctgactattttggagccaataggcatcctgct
ggtcttacctttccaacagctcctggattttcttttagcttccccggtctgtttccttca
ggcttgtaccacaggccacctttgctacctactagttctcctgttaaaggactaccgagc
gcagatcagacaaacaaaagtcaaagtcccctcatgaccagtcctcagatactgccagcc
acccaggatattttgaaggcactaaataagcaaccatctgtaggggaaaataagccagtg
gagcttcaaccagagaggtcctctgaagagaggccgcatgagaaactcagtgaccagtca
gagagtagtgaccttgacgatgtcagtacccccagtggcagtgacctggaaaccacctct
ggctctgatctggaaagtgacattgaaagtgagaaagagaaatttaaagaaaatggtaaa
atgttcaaagacaaagtaagctctctgcagagtttggcttcaataaataataagaaagac
cacagcaatcattccattttctcaccatctttagaggagcagactgcggtgtcaggagcg
gtgaatgattctataaaggctattgcttctattgctgagaaatactttggttcaacagga
cttgtggggctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctc
ccattttttccagcattctctcaatcaatgtatccatttcctgatagagacttgagaccg
ttacccttgaaagtggaaccccaatcacccagtgaactcaagaagatcccaaagggaagc
tctgagtctccctttgacctcaccactaagcgtaaggaggagaagcccgttactcccata
ccctcaaagccagcagctccgcctgcggcaagccaggaccagcctctagatctgagcatg
ggcagcagaagtcgagccagtggcacaaaacaggccgagcctcggaaaaaccacgtcttt
ggtgaaaagaaaggaggcgacctcgagcaaaggaaagcgtccgagtcctctttgcagcac
gcccgaccgactcccttctttatggatcccatttacagagtagagaaaagaaagttaact
gacccactcgaagctnttaaagagaaatacttgagaccttccccgggattcttgtttcat
ccacaattccaattgcctgatcaaagaatttggatgtcagccatcgagaacatggccgag
aagctggagagctttagcgccttgaagccagaggccaacgagctgatccagtcggtgccg
tccatgttcaacttccgagcccccccgagcgccctgcccgagaccctcctgcgcaagggc
aaggagcgctacacctgcagatactgtggcaagattttcccaagatctgcaaacctaacc
cgtcacctgaggacgcacactggagagcagccctacagatgcaaatactgtgacaggtcc
tttagcatatcttccaacctgcagagacatgtccgtaacatccacaataaagagaagcca
ttcaagtgtcacttatgtgacaggtgttttggtcagcaaaccaatcttgacagacatcta
aaaaagcatgagaacggcaacatgtctggtactgcaacgtcttcacctcactcagaactg
gaaagcacaggggcaatcctagatgacaaagaagattcttactttacagaaattaggaat
tttattggaaacagcaaccacaacaatcagtccccccggaactcagaggagagaatgaat
ggcagccactttaaggatgaaaaagccatggtaaccagccagaactcagatttgctggat
gacgaagaggcagaagatgaagtaatgatggacgaagaagacgaagaaagcgaaattgca
gggaaagcagtcaaagagcctgctacaagcgacatacacgaggggactccagaggaggat
tacgaggaaacgagtactttggacatgaactgcaaagcttcccctggcaggtataaagag
gaggagtatagtaagactggactttctgctttggaccacataaggcacttcacagatagc
ctcaaaatgaggaaaatggaagaaaatcaatatagtgaagctgaattggcagctttcaat
acttcccagctgccagaggacctaaaacaaccattatacaggaaatccaaatcccaggcg
tatgctatgatgctctctctctccgacaaggactcccttcattctgcatcccacaattct
cccaatatgtggcacagtatggcgagagctgctgcagaatccagcgccatccaatccatc
agtcacgtatga

DBGET integrated database retrieval system