KEGG   Anas platyrhynchos (mallard): 101794951Help
Entry
101794951         CDS       T02816                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta isoform X2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00564  Glycerophospholipid metabolism
apla00565  Ether lipid metabolism
apla00590  Arachidonic acid metabolism
apla00591  Linoleic acid metabolism
apla00592  alpha-Linolenic acid metabolism
apla01100  Metabolic pathways
apla04010  MAPK signaling pathway
apla04217  Necroptosis
apla04270  Vascular smooth muscle contraction
apla04370  VEGF signaling pathway
apla04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101794951 (PLA2G4F)
   00565 Ether lipid metabolism
    101794951 (PLA2G4F)
   00590 Arachidonic acid metabolism
    101794951 (PLA2G4F)
   00591 Linoleic acid metabolism
    101794951 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    101794951 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101794951 (PLA2G4F)
   04370 VEGF signaling pathway
    101794951 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101794951 (PLA2G4F)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101794951 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101794951 (PLA2G4F)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101794951 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 101794951
NCBI-ProteinID: XP_012957008
Ensembl: ENSAPLG00000002083
Position
5
AA seq 852 aa AA seqDB search
MFCEVLRGLVPHRVLPFLAAVLFQRKERRETGFYHWRWEKHPYYNLTVKVLRARNIKGTD
LLSKADCYVEMKLPTASPMVYRTQVVDNCDNPEWNETFQYRIHSAVKNILEMTLYDKDVL
VSDELTSIVFDVGGMKPGQPLLRTFKLNPEDNEELDVEFCLEKCSDTPTEVLTNGVLVVH
PCLSLQGTVNKEEKIKEKQQGSCAVKLSVPGAYQKQLCIPWRPDNEKDYGTSFVFHVDKE
MHPELQVELEQTISILQDGMNPDIEKHTTVLGQGTVPVNSLPVGQKVDRVVSLGEGQSLD
ISLKAEESTWDLDIRLGFDLCKEEREFVDKRKKLVSEVLKKTLNLKESPRKDEVPVVAVL
GSGGGMRALTSFYGSLAGLQQLGLLDAAVYLSGISGSTWCLSTLYQDPYWSQKDLQDAIN
RAQGIVSSSKGGAFSPERLKYYFQELNSMESSGRKVSFTDLWGLIVEYFLQQKEDASKLS
DQQEAVKWAQNPYPIYAAVNVRPNISSGDFAEWCEFTPYEVGFRKYGAFVRTEDFDSEFF
MGRLIQKRPEPRICFLQGMWGSAFAASLDDICLKVVGTGLSFLEPFKDVIKVIDDCRRSH
FRDPTRLKTRLVIPGGPLLQIFQDFFKSRVTCGETFNFMQGLYLHKDYVNVKKFVVRKGT
HLDAFPNQLTPMEESLYLVDGGFSINSPFPLVLQPERDVDVILSFNFSWEAPFEVLELAQ
KYCEEREIPFPKIKLSDEDEKKPKECYMFVDNNNPKAPIVLHFPLVNDTFRKYKAPGIER
ESEDEKSFGDFVIETKDSPYRTLNFTLEPYDFRRLVEVNRYNVLNNKDTLFKTLNLALQR
RKRKNVSSTSNT
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtgaggtgctgcggggtctggttccacacagagtgctgccttttctggcagct
gtgcttttccaaagaaaggagagaagagagactggattttatcactggcggtgggagaag
cacccttactacaacctaactgtaaaagtcctccgagccagaaacatcaagggtacagat
ctgctgtcaaaagcagactgctatgtggaaatgaaactgcccactgcatctccaatggtc
taccggactcaggttgttgacaattgtgataacccagagtggaatgaaaccttccagtac
cgaatccatagtgctgtcaagaacattttggaaatgacactctatgacaaggatgtccta
gtcagcgatgagctcacttccatcgtcttcgatgtaggaggcatgaagccaggtcagccc
ctgctgcgcactttcaagttgaaccccgaggataatgaagagctggatgtagagttctgc
ttggagaaatgctcagatacccctacagaggtattgaccaatggagtacttgtggttcat
ccttgtttgtctctgcaagggactgtcaacaaagaagaaaaaataaaagagaaacagcaa
ggtagctgtgcggtgaagctttctgttccaggggcgtatcagaagcagctgtgtattcct
tggagaccagataatgagaaggattatggaacctcctttgtttttcatgtggacaaagaa
atgcatccagaactgcaagtggagctggagcaaacaatatctatcctacaggatgggatg
aaccctgatattgaaaagcatactacagttctgggacaggggactgtaccagttaattcc
cttcctgttggacaaaaagttgatagagttgtttctctgggagagggacaaagtttggat
ataagtttgaaagctgaagagagtacttgggatctagatatacgtctgggttttgacctc
tgtaaagaggagagagaatttgtggacaaaaggaagaaattagtttctgaggtgctgaag
aagactcttaatttaaaggaatcccctcggaaagatgaggttccagttgtagcagtactg
gggtctggaggtgggatgagagcactgacttcattctatggcagcctagctgggcttcag
cagctgggccttctggatgctgcagtatatctgagtgggatttctggctctacttggtgt
ttatcaacattgtatcaagacccttactggtcacagaaagatcttcaagatgcaatcaac
agagctcagggtattgtgtccagcagcaaaggaggggcattttccccagaacgactgaaa
tactatttccaggagttgaattcaatggaaagtagtggacggaaagtgtccttcacagat
ttgtggggtcttattgtggagtatttcctacaacagaaggaagatgcatcaaagctgtct
gatcagcaagaagcagtgaaatgggcccagaacccttatcccatctatgcagctgtcaat
gtgagacccaatattagtagtggtgactttgcagaatggtgtgagtttactccctatgaa
gttgggtttcgcaaatatggagcttttgtccgaacagaggacttcgacagcgagttcttc
atgggaaggcttatccagaaacgtccagagcctagaatttgttttctacaaggaatgtgg
ggcagtgcctttgctgcaagcttggatgatatctgcttgaaagtagttggaacaggattg
agctttctagagcctttcaaagatgttatcaaagttatagatgactgtcgaagatctcat
ttccgagatccaacacgactgaagactcgcttggttatacctgggggccccttgttgcaa
attttccaggatttcttcaagtcccgggtcacgtgtggagagacattcaacttcatgcag
ggattgtatcttcataaagattatgttaatgtcaagaaatttgtggttcggaaaggcact
catctggatgcgtttcctaaccagttgacccccatggaagagagcttgtatttagtggat
ggtggcttttctatcaactctccctttccattggtacttcagccagagagagatgtggat
gttattttgtcgttcaatttctcctgggaagctccgtttgaggttttagagttggctcag
aaatactgtgaggagcgggagattccttttccaaaaatcaaactgagtgatgaagatgaa
aagaagccaaaagagtgctacatgtttgtggataacaataatccaaaggctcccattgtg
ctccatttcccattagtgaatgacaccttccggaaatacaaagctccaggcattgaacgc
gagtcagaggatgagaaatcctttggtgactttgtcattgagacaaaagattctccttac
cgtacactgaatttcacccttgagccatatgatttccgcaggttagtggaagtgaatcgc
tacaatgttctgaacaacaaggacactctcttcaaaaccctgaacttggctctgcaaagg
agaaagcggaagaatgtcagcagtacatccaatacatga

DBGET integrated database retrieval system