KEGG   Anas platyrhynchos (mallard): 101795292
Entry
101795292         CDS       T02816                                 

Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101795292
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101795292
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_9
Other DBs
NCBI-GeneID: 101795292
NCBI-ProteinID: XP_027317830
Position
7
AA seq 970 aa
MGPGAGPGAVAVPAVTRAGGCAGRARAAAADGGRSNPSKRHRERLNRELERLAALLPFPA
EVVAGLDKLSVLRLSAGFLRARSFFSVALKNHGANEAERDGDRDGSPAPGTAVAAVPEGE
LLLQALNGFVLVVTSEGLIFYSSHTIQDYLGFHQTDVMHQSVFELIHSEDQQEFRRNLHW
ALSPPHAPEGEPSPEGRKSLGSSAATYKPDQLPPENSSFLERSFVCRFRCLLDNSSGFLA
LNLQGRLKFLHGQNKRSEDGSALPPELALFAISTPLQPPSILEIRTKNMIFRTKHKLDFT
PLACDAKGKIVLGYTEAELRMCGTGYQFVHAADMLYCAENHVRMMRTGESGLTVFRLLTK
DKRWKWVQANARLVYKNGKPEYILVTQRPLVDEEGGEHLRKRSMHLPFTFATGEALLYQS
AYPLPGFSDAFQSKGRSSKSKKPSHNNGGHSQKDSIAPSSLLGAVLQQDKAAYIPCPSPA
PSHLFSSTFLGRLEDMSSLGAEGEAQSMDTALISSREDSFKKELVDLQQEDPLLATLDSL
SITSDESCSNSEFFSALESLGLNAEDLELLLLDEKMLMVNMDPARTPNLSDFLTNNEILS
YIHARLVNKSEGDPQACPLPVATSSPPGGSAAYLAQQTQQPGVVPGQATALLWDQPLREA
PGQPSPLPLRPSEAGKEPSGGLQWRPAGEESLLRLLHLAQGTPWAKAAGSPLGAPHPQGV
QQPEGGFPAVHPTQGDILQTFSLPSQFQGRGAPPRQPKCRAGRRLLMDRLCGHHSPSSPH
SLPTSSNSPWQDYVSPLLTTPAQPDFCGISQDLISQHQGCLGLAPGPGVLAVDFNLNGLC
SVETLGCGGSQEEMVPYSGFFPPSSYQLIPEKQLSPVPSMPQYPFLSPPAERFGSISSTL
EAPVNSCGVHTSVLSMDTRRQPDSSCVLPGAQMGLPGDMPKGSPAPSCKLRPRAEVLPDH
PHTSSNDFYL
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgggaccgggagcgggaccgggagcggtggcggtgcccgcggtgacacgggcgggtggc
tgtgccggcagggctcgggctgcggcggccgacggcggcaggtccaacccgtccaagcgg
caccgggagcggctgaaccgggagctggagcggctggcggcgctgctgcccttccccgca
gaggtggtggccggcctggacaagctgtcggtcctgcgcctcagcgccggcttcctccga
gccaggagcttcttcagcgttgctctgaagaaccacggtgccaacgaagcagagagggat
ggagaccgtgacggcagccccgctccaggcacggcagtggcggcagtaccagagggcgag
ctgctcctgcaggcactcaacggcttcgtgctggtggtaacgtcagaagggctgatattt
tactcctcgcacacaatccaggactacctgggatttcatcagacagatgtcatgcaccag
agcgtcttcgagctgatccacagcgaggaccagcaggaattcaggcgcaacctccactgg
gctctcagcccgccccacgctcccgagggggagccctctcctgaagggaggaagagtctt
ggctcttctgctgccacctacaagcccgatcagctgcccccagaaaactcttccttcctg
gaaaggagcttcgtgtgccggtttcgctgcctcctggataattcctctggcttcctggct
ctaaaccttcaaggcaggctgaaattccttcatgggcagaacaaaaggtctgaagatggg
tctgcactcccccccgagcttgctctttttgccatctccaccccgttgcagcccccatcc
atcctggagatcagaaccaagaacatgatcttcaggacgaagcacaagctggacttcacc
cccttggcgtgtgatgccaaggggaagattgttttgggctacactgaagcagagctgcgg
atgtgtggcacaggctaccagtttgtccatgctgccgacatgctgtactgtgccgagaac
catgtcagaatgatgagaacgggggagagcggcctgacggtgttccgcctgctgaccaag
gacaagcgctggaagtgggtgcaggccaacgcgcggctcgtctacaagaacggcaagccc
gagtacatcctcgtcacacagagacccctcgtagatgaagaaggaggagagcaccttcga
aaacggtccatgcatcttcccttcacctttgctactggagaagcactcttgtaccaaagc
gcttaccctctcccaggcttctcggatgctttccagagcaaagggaggagcagcaagtcc
aagaagccttcccacaacaacggagggcactcccagaaggacagcattgcccccagttct
ttgctgggtgccgtgctgcagcaggacaaggcagcgtacatcccttgcccatctcctgcg
cctagccacttgttcagcagcactttcttgggccgccttgaggacatgtcctcgctgggt
gcagagggagaggcccagagcatggacaccgctctgatttcctcaagggaagacagcttc
aaaaaggagctggtggatttgcagcaggaggaccctctcttggccaccctggactctctg
tcaattaccagtgacgagagctgctccaacagcgagttcttcagtgcgctggagagcctg
gggctgaacgccgaagacctggagctcctgctgctggatgagaaaatgctgatggtcaac
atggaccctgcccgcaccccgaacctgagcgatttcctcaccaacaacgagatcctctcc
tacatccatgccaggctggtgaacaaatctgagggagacccccaggcctgccccctgcca
gttgccacctcgagcccacctggaggctcagctgcatacctggcccagcaaacacagcag
cctggtgttgtcccaggccaggccactgctctgctgtgggatcagcccctccgtgaggca
ccagggcagccgtccccactgcccttgaggccatcagaggcagggaaggagccgtctgga
ggcttgcagtggaggcccgctggggaggagagcctgctccgcttgctccacctagcgcag
ggcaccccgtgggccaaagctgctggctcgcccctgggagccccgcacccacagggggtt
cagcagccagagggtggcttcccggccgtgcatcccacccaaggggacattctccagacc
ttctccttgcccagccagttccagggacgtggggcacccccaaggcagccaaaatgcagg
gctggccggcgcttgctgatggacaggttgtgtggccaccattccccctcttctccacac
tcccttcccacgagcagcaatagcccgtggcaggactatgtctccccgctcctgacaacc
ccagctcagcctgatttttgtggcatcagccaggacttgatctcccagcaccagggctgc
ttgggtctagcacctgggcctggcgtgctagcagtggacttcaacctaaacggattgtgc
agcgtggaaaccctcggttgtggggggtcccaggaggagatggttccatactcggggttt
ttccccccttcctcataccagcttattcctgagaagcagctgagccccgtcccctccatg
ccccagtaccctttcctgagcccccctgcagagcgttttggcagcatcagcagcacgctg
gaggcacccgtgaattcctgtggggtgcacacctccgtgctgagcatggacaccagacgt
cagcctgacagcagctgtgttttgcctggtgctcagatggggctccctggagacatgccc
aaaggcagccccgctccctcctgcaagctgcgccctcgtgcagaagtgctgccggatcac
ccccacacctccagcaatgacttctatctctag

DBGET integrated database retrieval system