KEGG   Anas platyrhynchos (mallard): 101796149
Entry
101796149         CDS       T02816                                 

Gene name
SIM2
Definition
(RefSeq) single-minded homolog 2
  KO
K09100  single-minded
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101796149 (SIM2)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101796149 (SIM2)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 101796149
NCBI-ProteinID: XP_005012946
Position
1
AA seq 767 aa
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRIGPLDNVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHPHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDL
KLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDIEYKELQLSLDQVTISKSQFSCRNSV
STSQETRKIVKPKSNKMKAKLRTTPYPQQQYSSFQTDKLECSQVGNWRSSPAVNAATIQE
QNFHSENSELLYAPSYSLPFSYHYGHFPVESHVFSSKKQMLPSKFGQSQGAPCEVARFFL
STLQTNGECQWHYANSLVPSSQSPSKNLPEQPVNIIRHNLAQSYEVPISNRRYNQDALSD
NFTSCTAPVPGSRYKEEIYDSGIMKPNKIENRIQPPHHLIKEENKLGFNRDLQEKMSINE
SSFSNSIANSLLPKSECFQPKAIGQLSHLLPVPSVYEQTRRICMKEPKYGHISHHATNLD
EVDSDERMSVKLDHDSESECVMDVRPSGQVPFVLLNYHHVLAKHGTFQTSSCTATGHVGE
NYGYNSEEVNTFIYKNQSPSSASSPETHKETALPHYIGTSVIIANGR
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgaaggaaaaatccaagaacgcggcaaagactagacgggaaaaagaaaatggagaattc
tacgaactggccaaactcctgcccctgccctcggccatcacctcccagctggacaaggcg
tccatcatccgcctcaccaccagctacctgaagatgcgagccgtcttccccgaaggtcta
ggcgacgcctggggacagccgagcaggatagggcccttggacaacgtggccaaggagctg
ggatcccatttgcttcagactttggatggctttgttttcgtggtggcatcagacggcaaa
attatgtacatctcagaaacggcatctgtacatcttggcttatctcaggtggagctaact
ggtaatagcatttatgagtatatacacccttctgaccatgatgagatgacagctgttctt
actgctcaccagcctcttcatcctcacctcttacaagaatatgaaattgagagatccttt
ttcctgagaatgaagtgtgtcctagccaagaggaatgcaggattgacatgcagtggctac
aaggtgatccattgcagtggctatttgaagatacggcagtatatgctagatatgtctttg
tatgattcctgttaccaaatcgttggactggtggctgtaggtcaatctttacctcccagt
gcaatcactgagatcaaacttcatagtaacatgtttatgttcagagcaagtttggactta
aaattaatattcctagattccagagtgactgaattaactggatatgagccccaagatctg
atagaaaaaaccctctaccaccatgttcatggctgtgatgtgttccatttacgatatgct
catcatctgttgctggtgaaaggccaagtcacaaccaagtactatcgactactgtccaag
catggaggctgggtttgggtacagagctatgctaccattgtgcataacagccgttcatca
cggcctcactgcatagtgagtgtcaattatgtccttacagatattgagtataaggagctt
cagctgtcactggaccaggttaccatttctaagtcacagttctcatgcagaaactcagta
tctacctcgcaggaaacaaggaaaatagtaaaacccaaaagtaacaaaatgaaggcaaaa
ctcagaacaacaccttacccacaacagcaatacagctcattccaaacagacaaactggaa
tgcagccaggtgggaaactggcgatccagccctgcagtgaacgctgccaccattcaagaa
caaaacttccattcagaaaacagtgaacttttatatgccccgtcatatagcttgcctttc
tcttaccattatggacacttccctgtcgaatctcatgtcttcagtagcaaaaagcaaatg
ctgccttctaagttcgggcagtctcaaggagcaccttgtgaagtggctcgttttttcttg
agtacgctgcagacaaatggagaatgccagtggcattatgccaactccttggtacccagc
agccagtcaccatccaaaaatcttcctgagcagccagtgaacatcatccggcataatctt
gcacagagttatgaagtgcccatatcaaacagaagatacaaccaagatgctctctctgac
aactttacaagttgcacagcacccgtgccaggcagcagatataaagaagagatttatgat
tccggcatcatgaaacccaacaaaatagagaacaggattcagccacctcaccatcttatt
aaagaagaaaacaagttaggctttaacagagacctacaagaaaaaatgagcattaatgaa
agttctttttcaaactcaatagctaattccttgctgccaaaatcagaatgtttccagcct
aaagctataggacaattaagtcatctcctaccagtgccctccgtatatgaacaaacaaga
cggatttgtatgaaagaacccaaatatgggcatattagtcaccatgctacgaatctagat
gaagtggacagtgatgagagaatgagtgtaaagctcgatcatgactctgaaagtgagtgt
gtgatggatgtaagaccctctggacaagttccatttgtgcttctaaattatcaccatgtt
ttagctaaacatggcacgtttcaaacttcatcatgtacagcaacaggacatgtaggagaa
aattatggatacaattctgaggaagtaaatacatttatttacaaaaaccaaagcccctca
tcagcttcttctccagaaacccacaaggaaactgcactaccacattatattggaacttct
gtaataatagccaatggaaggtga

DBGET integrated database retrieval system