KEGG   Anas platyrhynchos (mallard): 101796345
Entry
101796345         CDS       T02816                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain-containing protein 1 isoform X2
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101796345 (EPAS1)
   04131 Membrane trafficking [BR:apla04131]
    101796345 (EPAS1)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101796345 (EPAS1)
Membrane trafficking [BR:apla04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    101796345 (EPAS1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 SUIM_assoc HLH
Other DBs
NCBI-GeneID: 101796345
NCBI-ProteinID: XP_005009861
Ensembl: ENSAPLG00000007160
Position
3
AA seq 867 aa
MCSRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHNVSSHLDKASIMRLAISFLR
THKLLSSVCADNENELDADQQMDNLYLKALEGFIAVVTQDGDMIFLSENVNKYMGLTQVD
LTGHSIFDFTHPCDHEEIRENLSLKNGPGFGKKNKEMSTERDFFMRMKCTVTNRGRTVNL
KSATWKVLHCTGQVKVYNTCPPHTLCGYKEPLLTCLIIMCEPIQHPSNIDIPLDSKTFMS
RHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVTGQ
YRMLAKHGGYVWLETQGTVIYNTRNLQPQCIICVNYVLSEIEKNDIVFSMDQTESLFKPH
LLTMSTAFENGIPGTEKSDFLFTKLKEEPEELAQLAPTPGDAIISLDFGTQKFEEAPAFT
STVLTPNKPWPVEVKSHAAQGETLTIPSFTMPQIAPGSSTPSASSNSSCSTPSSPGDYYS
SVDEDLKIEVIEKLFAMDTESKNQCNSQTDFNELDLETLAPYIPMDGEDFQLSPICQEER
PLSESAQNTQQSLSSMSTIFQPLASASQNQFLPEKYCPQLSNKNINPGHGSLSSVFFNNM
SRSSLPPYHDQASTPLSSMGGRPNTQWPPDPPLEYVPAKWRLMDKYSGTLSSSPSGPPIH
SPGMPVYKKRPLDAFGQRGIDINPARIALSNSLKLKRQLDYEEQALQQLSGGDPSVTNPS
HLMWKRMKFLKGENCSLVSEKKSLSTSVLTDEFVCNSRGLSQPMNQLQQQQQQQQQQQQQ
QPTCGSPGENLKAGAFPPQFYSSHYQDYPAQPTHKVSGVTSRLLGPSFEPYLLPELTRYD
CEVNVPVLGSSTLLQGSELLRALDQAT
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgtgctccaggagcagttcagaacggaggaaggagaaatcaagagatgcagcaagatgc
agaagaagcaaagagaccgaagttttctatgaactggcccacgagctgcctcttccccac
aatgtcagttcccacctggacaaggcatccataatgcgcctggcaatcagtttcctacgc
actcacaagcttctgtcttcagtatgtgctgacaatgagaatgaactagatgcagaccag
cagatggacaacttgtacctgaaagctttggagggatttattgccgtggtgacacaggat
ggagacatgatctttttgtcagagaatgtcaacaaatacatgggtctcacccaggtggat
ttaactggacacagcatttttgacttcactcacccatgtgaccatgaagaaattcgagag
aatctgagtctgaaaaatggtccaggctttggaaagaaaaacaaggagatgtcaactgag
cgtgacttcttcatgaggatgaaatgcaccgttaccaacagaggcagaactgttaacctc
aagtctgccacctggaaggttttgcactgcactggacaagttaaagtgtataacacttgc
cctcctcacactttgtgtgggtataaagagcctcttctcacctgccttataataatgtgt
gagcctattcagcatccttcaaacattgacatacccctggacagcaagaccttcatgagt
cgccatagtatggacatgaaatttacctactgcgatgacagaataacagaactgattgga
taccacccagaggagctgctgggccgttcagcgtacgagttctaccatgccttggactca
gagaatatgaccaagagtcatcagaacttgtgcacaaaaggtcaagtggtgactggccag
taccgtatgcttgccaagcatggtggatacgtatggctggagactcaagggactgtcatt
tacaacacgcgcaacctacagcctcagtgcatcatctgtgtcaactatgtgctgagtgaa
attgagaagaatgatatagtgttctctatggaccaaacggaatcgctcttcaagcctcac
ctgctcacgatgagcactgccttcgagaacgggatccccgggacagagaagagtgatttc
ttgtttactaagctaaaggaagaaccagaggaacttgcgcagctggcaccaacacctgga
gatgccattatttccctggattttgggacacagaagtttgaggaagcccctgcctttacc
agcactgttttgacaccaaataaaccctggccagtggaagtgaaaagccatgccgctcaa
ggtgaaacactgacgataccatcctttaccatgcctcagattgcacccggcagcagtact
ccaagtgcaagcagcaacagtagctgttccacgccaagcagcccaggagattattacagt
tctgtggatgaagatctgaagattgaggtgattgaaaaactctttgccatggacacagaa
tcaaaaaatcagtgcaactcccagactgacttcaatgaactggaccttgaaaccttggct
ccttacattcctatggatggagaagatttccagctcagcccgatatgccaagaagaacgt
cctctctctgaaagtgcacaaaatacccagcagagtctaagtagcatgagtactatcttc
caaccccttgcttctgcttcacagaatcagttcctcccagagaagtattgcccacagcta
tcaaataaaaacattaaccctggtcatgggtcactgtcatctgtgttcttcaataatatg
agtaggtcatcgctgccgccataccacgaccaagccagcactcccctgtcttcgatggga
ggaagaccaaacacccaatggccacctgatcccccattagaatacgttccagctaaatgg
agactcatggataaatactcaggaaccttatcaagttcaccctcagggcccccaatacat
tctcccggcatgcccgtatataaaaaaaggccactggatgcttttgggcaacgaggcata
gatataaacccagcaagaattgctctgtctaatagtttgaaactgaagcgacaactggat
tatgaagaacaagcattgcaacaactgagtgggggagatccatctgtcactaacccatct
cacttaatgtggaagagaatgaaatttctcaaaggggaaaattgttccttggtttcagaa
aagaagtctctcagcacaagtgttcttactgatgagtttgtctgtaactcaagaggcctg
agccaaccaatgaatcaactgcaacagcaacagcagcaacagcaacaacagcagcaacag
caacccacctgtggcagtcctggtgagaatttgaaagcaggagcgtttccccctcagttt
tacagttcccattatcaggactatcctgcccagccaactcataaagtatcaggtgtgaca
agtcgtctgctgggaccctcctttgaaccatatttgttgcctgagttgacaagatatgac
tgtgaggttaacgtccctgttttgggcagttccacgcttctgcagggcagtgaactgctc
agagccctggaccaggcaacctga

DBGET integrated database retrieval system