KEGG   Anas platyrhynchos (mallard): 101796419Help
Entry
101796419         CDS       T02816                                 

Gene name
IDE
Definition
(RefSeq) insulin-degrading enzyme isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:apla01002]
    101796419 (IDE)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     101796419 (IDE)
Peptidases and inhibitors [BR:apla01002]
 Metallo peptidases
  Family M16: pitrilysin family
   101796419 (IDE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Tn916-Xis
Motif
Other DBs
NCBI-GeneID: 101796419
NCBI-ProteinID: XP_027316487
Ensembl: ENSAPLG00000004758
Position
6
AA seq 1022 aa AA seqDB search
MRRLPGLRRALLGLVHPCAAPASRLASQSRRRSFLGLQKETKNKMNNPAIKRITNEIIKS
PEDKREYRGLELANGIKALLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLG
TKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDES
CKDREVNAVDSEHEKNLMNDAWRLFQLEKATGNPNHPFSKFGTGNKLTLETRPTKEGIDV
RQELLKFHSTYYSSNLMAICVLGRESLDELTSLVVKLFSEVENKNVPIPEFPEHPFQEEH
LRQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKAKGWVY
TLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRTEGPQEWVFQECKDL
NAVAFRFKDKERPRGYTSKLGGMLHYYPIEEVLAAEYLLEEFRPDLIEMVLDKLRPENIR
VAIVSKSFEGKTDRTEDWYGTQYKQEAISDEVIKKWQNADLNGKFKLPMKNEFIPTNFEI
LPLEKDATQYPALVKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYL
ELLKDSLNEYAYAAELAGLNYDLQNTIYGMYLSVKGYNDKQHILLKKIIEKMATFEIDEK
RFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIS
QLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDRGWF
VYQQRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGP
RRANGIQGLRFIIQSEKPPHYLESRVEAFLKTMEKCIEDMSEEAFQKHIQALAIRRLDKP
KKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLTKDDIIQFYKVLLAVDAPRRHKVSVH
VLAREMDSCPVVGEFPCQNDVNLAPAPPLPQPSVIENMTEFKRSLPLFPLVKPHINFMAA
KL
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcttcccgggctgaggcgggctctgctcggcttggtgcacccctgcgccgcc
ccggcctcccgcttggcctctcagagccggcggcgcagcttcctcgggcttcagaaggag
acaaaaaacaaaatgaacaatccagctattaagagaataacaaatgaaattatcaaatca
cctgaggataaacgagaatatcgtggactggaactggcaaatggcattaaagcgcttctc
attagtgaccccaccacagataagtcttcggcagcactagatgtgcacatagggtccttg
tctgatccccctaacattgctgggcttagtcatttttgtgagcatatgctgttcctggga
accaagaaatacccgaaagagaacgagtatagtcaatttcttagtgagcatgcagggagc
tccaatgcctttaccagtggagagcataccaactattactttgatgtgtcacacgaacat
ctagaaggtgcactggacagatttgcccagtttttcctgtgccctttgtttgatgaaagc
tgcaaagatagggaagtgaatgctgttgattctgagcatgaaaagaatctgatgaatgat
gcctggaggctgtttcagttggagaaggctactggaaaccctaatcatcccttcagtaaa
tttggaacagggaacaaactcactctggaaactagaccaaccaaggaaggaatagatgta
agacaagagttattgaagttccattctacttattattcatcaaatttaatggctatttgt
gtcttaggaagagaatccttggatgagctaacttccttagtggtgaagttattttcagaa
gtagagaataaaaatgtccctataccagagtttcctgaacatcctttccaagaagaacat
ctccggcaactttacaaagtggtgcctattaaggacatcagaaatctttatgtcacattt
cctataccagaccttcagaagtactataaatcaaatcctggccattatcttggtcatctg
attgggcatgaaggcccagggagtcttttgtcagagcttaaagccaaaggatgggtatat
actcttgttggaggacagaaagaaggtgctagaggtttcatgtttttcatcattaatgtg
gatttgacagaggaaggacttttgcatgttgaagatattattttgcacatgtttcagtat
attcaaaaactacgtacagaaggacctcaagaatgggttttccaagagtgcaaggatcta
aatgctgtggcattcagatttaaagataaagaacgaccacgaggttatacatcgaagctt
ggaggaatgttgcattattatcctatagaagaagtattggctgctgagtatttgcttgaa
gaattcaggcctgatttaatagagatggtactggataaattgagaccagaaaacattcga
gttgcaatagtgtccaagtcttttgaaggaaaaactgaccgaacagaagactggtatgga
acacagtacaagcaagaagcaatttctgatgaagttattaagaaatggcaaaatgctgac
ctgaatgggaaattcaagcttccaatgaagaatgagttcattcctactaactttgagatt
ttgccattggaaaaagatgcgacacagtaccctgcccttgtcaaggacactgctatgagc
aaactgtggttcaagcaagatgacaaattttttttgccaaaagcttgtctcaactttgag
tttttcagcccatttgcttacgtggatcccttgcattgtaacatggcctatttgtacctt
gaactactcaaagactccctcaacgagtatgcatatgcagcagaactagctggcttgaac
tatgatctccaaaataccatctatgggatgtatctttctgtaaaaggttataatgacaag
caacatatcttgctcaagaagatcatagagaaaatggctacttttgagattgatgaaaaa
agatttgaaattatcaaggaagcgtacatgagatcgcttaacaacttcagggctgaacag
cctcaccagcatgcgatgtattatctcagactcctgatgacagaagttgcttggaccaaa
gatgaattaaaagaagctcttgatgatgtcactcttccccgcctgaaggcctttatatct
cagttgttgtcacggttacacatcgaagctcttctccatggcaatataacaaaacaggct
gcattaggaattatgcagatggttgaggacactctcatagagcacgctcatacaaagcca
ctccttcccagtcagctagtgagatacagggaagtgcaacttcctgacagagggtggttt
gtatatcaacagagaaatgaagttcataacaattgtggcattgaaatatattaccagaca
gatatgcagagcacttctgagaatatgtttttggagctcttttgtcagattatttcagaa
ccatgcttcaatactctgcgcaccaaggaacaattaggttacattgtgttcagtggtccg
cgtagggcaaatggcatacaaggactgcgatttattatccaatctgaaaagccaccacac
tatttagaaagcagagtggaagcattcttaaagactatggagaaatgcatagaagatatg
tcagaagaggccttccaaaaacacatccaagctttagcaattcgtcgtctagacaaacca
aagaagctgtctgcagaatgtgctaaatattggggagaaataatttctcagcagtataac
ttcgacagagataacattgaagtggcttatctaaagaccctgaccaaggatgatatcata
cagttctacaaggtgctgttggcagtagatgctcccagaagacacaaggtatcagtacac
gtccttgcaagggaaatggattcctgccctgttgttggagagtttccatgccaaaatgat
gtgaacctggcaccagcaccaccactaccacagccaagtgtgattgaaaatatgacagag
ttcaagcgcagtctgccactctttcccctggtgaaaccacatatcaatttcatggctgca
aaactgtga

DBGET integrated database retrieval system