KEGG   Anas platyrhynchos (mallard): 101796985Help
Entry
101796985         CDS       T02816                                 

Gene name
VPS41
Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:apla04131]
    101796985 (VPS41)
Membrane trafficking [BR:apla04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    101796985 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_1 Vps39_2 ANAPC4_WD40 zf-RING_5 zf-RING_2 zf-rbx1 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 101796985
NCBI-ProteinID: XP_027307168
Ensembl: ENSAPLG00000005152
Position
2
AA seq 876 aa AA seqDB search
MTAAGRAMAEAAEKESGYNEESTDESECFAPTLPTEVQHLVKEDESEEEPKLKYERLSNG
VTEILQKDAASCMTVHEKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESGEH
MGVCSEDGKVQVFGLYSAEEFHETFDCPIKIVAVHPHFVRSHFKQFVTGGKKLLLYERGW
MNRWKPSVLHEGEGNIRNIKWRGHLIAWANNMGVKILDMISKQRITNVPRDDISLRPDMY
PCSLCWKDNLTLIIGWGNSVKICSVKERHASEMRDLPNRYVEIVFQFDTEFYISGLAPLC
DQLVILSYVKEISEKTEVECCARPRLDIVQPLPESCEEISSDALTVRGFQENECRDYHLE
YSEGESLFYIISPRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKTVKKHKILDIG
LAYINHLVEKGEYDLAARKCQKILGKNTELWEFEVYKFKEIGQLKAISRYLPRRDPILKP
LIYEMVLHEFLESDYEGFATLIKEWPGDLYNNTIIVQAVVDHLKKDPQNRTLLRTLAELY
TYDQRYGRALEIYLTLRHKDVFQLIHKHNLFSSIRDKIVLLMDFDSEKAVDMLLDNEDKI
SIDRVVEELENRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHC
PLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELQDVDKAIEFAKEQDDGELWED
LILYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLRE
GCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDASKSFNVVVFHCRHMF
HKECLPVSNTVSSVQFCNICSAKHRGPGSTILEMKK
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgccggccgcgccatggcggaagccgcagagaaggaaagtgggtataatgaa
gaatcaacagatgaatctgagtgttttgcccctacccttcctacagaggtgcagcatctt
gtaaaggaagatgagagtgaagaagagcctaagctgaagtatgaacggctttctaatgga
gtgactgaaattctacagaaggatgcagccagctgcatgacggtgcatgaaaagtttttg
gcactgggaacacattatggcaaagtttatttacttgatgtccaggggaacatcacacag
aagtttgacgttagcccggtgaagataaatcagatcagtctggatgaaagtggagaacac
atgggtgtttgctcagaagatggcaaggtgcaagtgtttggattgtattcagcggaagag
tttcatgaaacgtttgactgtcctattaaaattgttgctgttcatcctcattttgtaaga
tctcacttcaagcaatttgtaacaggagggaaaaagttgctgctatatgagagaggctgg
atgaatagatggaagccttcggttttacatgaaggggaaggaaacataagaaacataaaa
tggagaggacatttaattgcttgggccaataatatgggcgtgaagatacttgacatgatt
tccaagcaacgaattaccaacgtccctcgagatgacataagccttcgccccgatatgtat
ccctgcagcctttgctggaaggataatttaacgctgattattggctggggaaattcagta
aagatttgctcagtaaaggagcggcatgccagtgaaatgcgtgaccttccaaaccgctac
gtggaaatagttttccagtttgatactgagttttatatcagtgggctcgcacctctttgt
gaccagcttgttatactttcatacgtaaaggagatttcagaaaaaacggaggtggagtgt
tgtgcgcggcccaggctggacattgtacagcccctgcctgagtcttgtgaggagatttct
tctgatgcgctaacagtacgaggatttcaggaaaatgaatgtagagattatcatttagag
tattcggaaggtgaatcacttttttatatcatcagcccaagagacgtggttgtggctaaa
gagcgggaccaagatgaccacattgactggcttctggaaaagaagaaatatgaagaagct
ttgatggcagctgagatcagtcagaaaaccgtaaaaaagcacaagattttggacattggc
ttagcctatataaatcacctagtagagaaaggagagtatgatctggctgctcgaaagtgc
cagaaaattcttggcaaaaacacagaactctgggaatttgaagtttacaagtttaaagaa
ataggtcagcttaaggcaattagtcgttacttgcccagacgggatccaattttgaaacct
cttatctatgagatggtcctgcatgagtttttggagagtgactatgaggggtttgcaaca
ctgataaaagagtggcctggagatctctacaacaatacaatcatagttcaagctgtagta
gatcacctgaagaaagatccacagaataggactttgctaagaacacttgcagaactgtat
acttatgaccagcgctatggcagagccctagaaatttacctaactctgaggcacaaagat
gtcttccagttgatccacaagcacaatcttttcagttccatcagagataaaattgttctg
ctcatggattttgattcagagaaagcagtagacatgcttttggacaatgaagataaaatt
tccatcgacagagttgttgaagagttagaaaacagacctgaactacagcatgtgtatttg
cacaagcttttcaaaagagatcaccataaaggacaacgatatcatgagaaacagatcagt
ctttatgctgaatacgatcgtccaaatttactaccatttctcagagacagcacacactgt
ccactagagaaggctctagagatctgccaacagaggaactttgtagaagagacagtctat
cttctgagtagaatgggcaatagccgcagtgccttgaagatgataatggaagaactgcaa
gatgtagataaagctattgaatttgccaaggaacaagatgatggagaactttgggaagat
ctaattttatattctattgacaaaccaccttttattactggtttgttgaacaatattgga
acacatgttgatcctattcttttgatccaccgcattaaggaaggcatggagattcctaat
ttgagagactctctagtgaaaattcttcaggattacaacttgcagatcttgctgcgggaa
ggttgcaagaagatacttgttgccgactctctttctttgttgaagaaaatgcatcgaact
caaatgaagggtgttctagtggatgaagagaatatctgtgagtcatgcctttctccaata
cttccttcagatgcatccaagtccttcaatgtggtagtgttccactgcagacacatgttt
cacaaagagtgtctcccagtatctaacacagtatcttctgtccagttctgcaacatatgc
agtgccaaacaccgagggccaggaagtacaatcctggagatgaagaaatag

DBGET integrated database retrieval system