KEGG   Anas platyrhynchos (mallard): 101797071Help
Entry
101797071         CDS       T02816                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    101797071 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 101797071
NCBI-ProteinID: XP_027328901
Ensembl: ENSAPLG00000003899
Position
21
AA seq 581 aa AA seqDB search
MMAAGPLLLLLLLLLGAAGPGLGAPGQGSGAALREELLLRPLPAGDVAAAFQFRTRWDAD
LRRGAVSHYRLFPKALGQLVAAQGVRELHLALTQGFWRTQSWGQPPLGAPAGAELWVWFQ
DSVPDVDKAWKELSNILSGIFCASLNFIDSTNTVTPTASFKPLGLANGTDHRLLRYAVLP
REVVCTENLTPWKKLLPCGSKAGLAVLLKAERLFHSSYHSQAVHIRPICRDASCLAVSWE
LRQTLTVVFDSFTSGQGKKDWSLFKMFSRTLTDACPLASESKVYVDISPKNKEKELLEVT
PTPTSLHEAVVQGDKRTYAVYDLLSPSLFNSSRSLNVQLKWKRPQDSQELSTPVLHAQRY
VSGYGLQTGEISTLIHNTHPYRAFPVILLETVPWYLRLYVHTLTIITKGKENKPSYIHYQ
PAQDRKRPHLLEMLIQLPANSVTKVTIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPS
VIAMKDVDVEESPLFASLFPSSDGSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVA
VCYGSFYNLLTRTFHVEEPSRGGLAKRLANVIRKFRGVPPL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcggggccgctgctgctgctgctgctgctgctgctgggggcggcggggccg
gggctgggggcaccggggcagggctcgggggcggcgctgcgggaggagctgctgctgagg
ccgctgcccgcgggggacgtggccgccgccttccagttccgcacgcggtgggacgccgac
ctgcggcggggggcagtctctcactacaggctcttcccgaaggcgctggggcagctggtg
gcggcgcagggcgtgcgggagctgcacctcgccctgacgcagggcttctggcgcacacag
agctgggggcagccgcccctgggcgcccccgctggtgccgagctctgggtctggttccag
gactccgtccccgatgttgacaaagcctggaaagagctgagtaacatcctctcgggaatc
ttctgcgcttctctgaacttcatcgactccaccaacacggtcacgccaacagcgtccttc
aaacccctgggcttagccaacgggacggatcaccgcctgctgcgctacgctgtcctgccc
cgggaggtcgtctgcacagagaacctcacgccctggaagaagctgctgccgtgtggctca
aaggccggtctggccgtgctgctgaaggctgagcggctgttccacagcagctaccactcg
caggccgtgcacatccgccccatctgccgggatgcttcctgcctggctgtttcctgggag
ctcaggcagaccctcactgtggtctttgacagctttaccagtggccaaggaaagaaagac
tggtccttgtttaagatgttctctcgcacccttactgacgcgtgtcctctggcatcagag
agcaaggtctacgttgacatctcccctaagaacaaggaaaaagagctactggaagtgacc
cccactccaacgtctttacatgaagctgttgtgcagggagacaagagaacctacgcggtc
tacgacctgctcagcccctcactcttcaattcatcccgcagcctcaacgtgcagctgaag
tggaagcggccccaagacagccaggagctgtcaacacccgtgctccacgctcagcgctac
gtgagcgggtacgggctgcagactggtgaaatcagcactctgatccacaacactcacccc
taccgggccttccccgtgatcctgctggagaccgtgccgtggtatctgcggctctacgtg
cacaccctgactatcatcacgaaggggaaggaaaacaagccaagttatatccactaccag
ccagcgcaggaccgcaaacggcctcacctgctggaaatgctgatccagcttccagccaac
tctgtcaccaaggtcacaatccagtttgagagagccttgctgaagtggacagagtacacg
cctgacccgaatcacggattttacgtcagtccctctgtgcttagtgccctggtgcccagt
gtcattgcaatgaaggacgtggacgtggaggagagcccgctcttcgcctcgctcttccct
tcctccgatggctccagctatttcgtgcgcctctacacggagccgctgctggtgaactta
ccgacgccggacttcagcatgccctataacgtcatctgcctgacctgcaccgtggtggcg
gtgtgctacggctccttctacaacctgctgaccagaacctttcacgtggaagagccgagc
cggggagggctggccaagcggctggctaacgtcatccgtaagttcaggggcgtgccgccc
ctctga

DBGET integrated database retrieval system