KEGG   Anas platyrhynchos (mallard): 101797658Help
Entry
101797658         CDS       T02816                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla03040  Spliceosome
apla04010  MAPK signaling pathway
apla04141  Protein processing in endoplasmic reticulum
apla04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101797658 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101797658 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101797658 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101797658 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:apla01009]
    101797658 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:apla03041]
    101797658 (HSPA2)
   03009 Ribosome biogenesis [BR:apla03009]
    101797658 (HSPA2)
   03110 Chaperones and folding catalysts [BR:apla03110]
    101797658 (HSPA2)
   04131 Membrane trafficking [BR:apla04131]
    101797658 (HSPA2)
   03051 Proteasome [BR:apla03051]
    101797658 (HSPA2)
   03029 Mitochondrial biogenesis [BR:apla03029]
    101797658 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apla04147]
    101797658 (HSPA2)
Protein phosphatases and associated proteins [BR:apla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101797658 (HSPA2)
Spliceosome [BR:apla03041]
 Complex B
  Other components
   Prp19 complex
    101797658 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    101797658 (HSPA2)
Ribosome biogenesis [BR:apla03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101797658 (HSPA2)
Chaperones and folding catalysts [BR:apla03110]
 Heat shock proteins
  HSP70 / DNAK
   101797658 (HSPA2)
Membrane trafficking [BR:apla04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101797658 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101797658 (HSPA2)
Proteasome [BR:apla03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101797658 (HSPA2)
Mitochondrial biogenesis [BR:apla03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101797658 (HSPA2)
Exosome [BR:apla04147]
 Exosomal proteins
  Proteins found in most exosomes
   101797658 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig Hydantoinase_A MetOD2
Motif
Other DBs
NCBI-GeneID: 101797658
NCBI-ProteinID: NP_001297704
Ensembl: ENSAPLG00000001031
UniProt: B2ZP77
AA seq 634 aa AA seqDB search
MSGKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVVNEGGKPKVQVEYKGEMKTFFPEEI
SSMVLTKMKEIAEAYLGRKVQNAVTTVPAYFNDSQRQATKDAGTITGLNVMRIINEPTAA
AIAYGLDKKGTQAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VNHFVEEFKRKHKRDIAGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVSAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAEDEANRDRVG
AKNSLESYTYNMKQTVEDDKLKGKISDQDKQKVLDKCREVISWLDRNQMAEKEEYEHKQK
ELEKLCNPIVTKLYQGAGGAGAGGSGGPTIEEVD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaaagggccggcgatcggcatcgacctgggcaccacgtactcgtgtgtgggc
gtcttccagcatggcaaagtggagatcatcgccaacgaccagggcaaccgcaccacgccc
agctacgtggccttcaccgataccgagcggctcatcggcgacgccgccaagaaccaggtg
gcgatgaaccccaccaacaccatctttgatgccaagcgcctcatcggccgcaagtacgat
gaccccaccgtgcagtcggacatgaagcactggcccttccgcgtggtgaacgagggtggc
aagcccaaggtgcaggtggagtacaagggcgagatgaagaccttcttccccgaggagatc
agctccatggtgcttaccaagatgaaggagattgctgaggcctatctggggcgcaaggtg
cagaacgctgtcaccacggtgcctgcttacttcaatgactcccagcgccaggccaccaaa
gatgctggcaccatcaccggcctgaacgtgatgcgtattatcaacgagcccacagcagct
gcgatagcctacggcttggacaagaaaggtactcaggctggcgagaagaacgtgctcatc
tttgacttgggagggggcacttttgatgtttccatccttaccattgaggatggcatcttt
gaggtgaagtccacagctggggacacccacctggggggggaggactttgacaaccgcatg
gtgaaccactttgtggaagaattcaagcgtaagcacaagcgtgacattgctggcaataag
cgtgcggtgaggcgactgcgtacggcttgcgagagggcgaagcgcactctcagctcttcc
acgcaagctagcattgagatcgactccctgtacgagggcattgacttctacacttccatt
actcgtgcccgctttgaggagctcaatgccgacctcttccgtggcaccctggagcctgta
gaaaaggccctgcgtgatgccaagctagacaagggccagatccaggagatcgtgctggtt
ggaggttccacccgtatccccaagatccagaaactactacaggacttcttcaatggcaaa
gagctcaacaagagcatcaatcctgatgaggctgttgcttacggtgcggccgtgcaagcg
gctatcctcatgggagacaagtccgagaacgtgcaggatctgctcctgctggatgtcacc
cccctgtccctgggcatcgagacagccggcggggtgatgaccgccctcatcaagcgtaac
accaccattcccaccaaacaaacgcagaccttcaccacctactcagacaaccagagcagt
gtcctggtccaggtgtacgagggtgagagggccatgaccaaggacaacaacttgctgggc
aagtttgatctgacaggcatccccccagcgccccgtggggtcccccagatcgaggttact
ttcgacatagatgccaatggtatcctgaacgtcagtgcggtagacaagagcacgggtaag
gagaacaagataaccatcaccaacgacaagggtcgcctcagcaaggatgacattgaccgt
atggtgcaagaagcagagaaatacaaagcagaggatgaagccaacagagatcgggtggga
gccaagaactcgctcgagtcctacacttacaacatgaagcagacggtggaggatgataaa
ctgaagggaaagatcagtgaccaggacaagcagaaagtgctcgacaagtgccgggaggtg
atctcttggctcgatcgcaaccagatggctgagaaagaagagtacgagcacaagcagaaa
gagctggagaaactctgcaacccgatcgtcacaaaattgtaccagggagctggaggagct
ggggcaggtggatccggtggcccgaccatcgaagaagtagattaa

DBGET integrated database retrieval system