KEGG   Anas platyrhynchos (mallard): 101797824
Entry
101797824         CDS       T02816                                 

Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:apla03021]
    101797824
Transcription machinery [BR:apla03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101797824
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int MACPF
Other DBs
NCBI-GeneID: 101797824
NCBI-ProteinID: XP_027301970
Position
1
AA seq 897 aa
MTHSWPPPLSAIHTPGKAEQSKFSFPNKESQQGSTGHSNTRKSDVEPKSPEKSATHTSML
EDDLKLSSDEEENDQQAAQRSALRVLSDSSLVVPQSSTRAPGLSSKGSSSSSSSESETSS
ESDSESESSSSESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALD
AHPYYGHVKAERQEGEKTPATGPAEHRSGEGRTTTVTTTATVGDGPRPRTANKAPGSKGG
RQKSPPAADGGPPRRAAGKKAPRRAERTSAGDGSHCRGAEEPTGSHGFLESTTGEAPRAR
PVGGGSGGGCRAGHRREPRSATAGEKRRARGPSKTAPKSKEFIETESSSSSSSSDSGSES
EREERPLPKAPAAAGAEPRTKDAGTGAASKPHGGCSAFGSINARTSSEIAKELEEQFYTL
VPFGRNELLSPLKDSDEVKSLWVNIDLALLSRIPERLPEEPLAMSAGANQAASLPQGSSA
DPPAEKGLPKSRRKRKCENEEEYRDIKKTHLERESSSRLAASAHNITTANHCNMNENSLA
IPINKNEKMLRSPVSPLSDASKHKYSNDDLTSSSRPNGSSLLPSISSSKKHKGEIQSQPH
PGDFNKAIHINSENILCNKPQSQTEPWSPLSGAPRDCRRTKLIFDDMPRNADYFMQEAKR
KKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLK
THSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAAQNPSP
WGTSGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPSPIISIPQRIHQMAANHVSITNSIL
HSYDYWEMADNLAKENRDFFNDLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgacccattcttggcctccaccactatcagctattcacacaccagggaaggcagaacaa
agcaagttttccttcccaaacaaggagtcacaacagggatctacaggacacagcaataca
agaaaaagtgatgtagagccaaagagtccagagaaaagtgcaacacatacatcaatgcta
gaagatgacctcaagttaagcagcgacgaagaagagaacgaccagcaggcagcacagaga
tctgctctccgcgttctgtctgacagcagcctggtggtgccgcagtccagcacccgcgcc
ccgggactctccagcaaggggtcgagcagcagcagctccagtgaatccgagaccagctcg
gagtctgactcggagagcgaaagcagctccagcgagagcgacggcagcaagccctcacat
tactccagcccagagcctgagccaccctcgtccaacaagtggcagctggacaagtggctg
aacaaagtcacccctcacaaagcacccatcctgacccaccatgacggcccggcactggat
gcccatccctactacggccacgtgaaggcggagcggcaggaaggcgagaagaccccggcc
accggcccagccgagcaccgcagcggggagggccgcaccaccaccgtcaccaccaccgcc
accgtcggggacgggccacggcccaggaccgccaacaaagcaccaggcagcaagggtggc
cggcagaagtcacccccggctgctgacggcgggcctccaaggagggcagcagggaagaaa
gcgccgcggcgggctgagaggacctcagctggggacggctcccactgccgtggggcagag
gaacccaccgggagccacggctttctggagagcaccactggcgaggcaccgagagcccga
cctgttggcggtggcagcggtggaggctgcagagcagggcaccgccgggagccccgctca
gccacagccggcgagaagcgccgggcacgggggccgagcaaaacggcacccaaatccaag
gagttcatcgagactgagtcctcctcctcgtcatcttcctctgactcgggctctgagtcg
gagcgggaggagcgcccgctgcccaaggcaccagcggcagctggggctgagccgcgcacc
aaggacgcggggaccggtgccgccagcaaaccccacggcggctgcagtgcctttggctcc
attaatgccaggactagtagtgaaatagcaaaggagctggaggaacagttttacaccttg
gttcctttcggtaggaatgagctcctgtctcctctgaaagacagtgatgaggtaaagtca
ctgtgggtcaacattgacttggctcttttgtccaggattccagagcgtttgcccgaagag
ccgctggcaatgagcgccggagcaaaccaggcggccagcctcccgcagggtagtagtgct
gacccccccgcagagaagggtttaccgaaatctagaaggaaacgcaagtgtgagaatgaa
gaagaatacagagacatcaagaagactcatttagagcgagagagttcttcacgattagct
gcctctgcccataacatcacaacagcaaatcactgcaatatgaatgaaaatagcttggca
ataccaataaataaaaatgagaaaatgcttcggtcacctgtctctcccctctctgatgca
tcaaaacacaaatactccaacgatgatttaacttcctccagcagacctaatggcagcagt
ctattaccttccatctcctccagcaaaaaacataagggtgaaatccagtctcagccacat
cccggagacttcaataaagcaattcacatcaattcagaaaacattctctgcaataagcca
cagtcccaaacagagccttggtcacctctgtccggcgcacccagggactgcagaaggaca
aagcttatctttgatgatatgccacgcaatgcagattactttatgcaggaagctaaacgg
aagaagcataaagcagatgcaatggtggaaaagtttggaaaggcactgaattatgcagaa
gcagcactatcgtttattgagtgtggaaatgcaatggaacaaggcccaatggaatctaaa
tccccctatacaatgtattcagaaacagttgaactcatcaggtacgcggtgagactaaaa
acccactcaggccccaacgccacgccagaagacaaacagctggcagcattatgttaccgc
tgcctggcccttctgtactggaggatgttccgactcaagagagaccatgctgtcaagtat
tcaaaagcacttattgagtattttaagaattcatcaaaagctgcccagaacccatctcct
tggggtaccagtggaaagagcacaggaactccatcacccatgtcccctagcccttctcca
gtcagctctgtagggtcccaggggagcacaggggccccttccccatctcctataatcagc
atcccacagcgcattcatcagatggctgccaaccacgtcagcatcaccaacagcatcctg
cacagctacgactactgggagatggctgacaacctggccaaggaaaacagagattttttt
aatgacttggatgcattgatgggacctatcaccttgcacagcagtatggagcatttagtt
cagtacactcaacaaggacttcactgggtgcggaatagcgctcacttgtcataa

DBGET integrated database retrieval system