KEGG   Anas platyrhynchos (mallard): 101797949
Entry
101797949         CDS       T02816                                 

Gene name
CLOCK
Definition
(RefSeq) circadian locomoter output cycles protein kaput isoform X1
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101797949 (CLOCK)
   03036 Chromosome and associated proteins [BR:apla03036]
    101797949 (CLOCK)
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101797949 (CLOCK)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101797949 (CLOCK)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101797949 (CLOCK)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9
Other DBs
NCBI-GeneID: 101797949
NCBI-ProteinID: XP_005012772
Ensembl: ENSAPLG00000007176
Position
4
AA seq 860 aa
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESITPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLETDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQPTYEYVKFIGNFKCLNNVPNSAHNGFEGTIQRS
HRPSYEDKVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEIKTDKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSRSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQSLSAHEKSTQRRSSL
SSQSLSSQSLGQPVTQPTVSQPATLQLQSNVSQPVFQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQIVHGQGLQMFLQQSASGLNFSSVQLTSGNSSNVQQLAPINMQ
GQVVQSNQTQSGMNTGHTSTPHMIQQQPLQSTASQHNQQNVLSGHSQQSSLASQSQSTVS
APLYNTMVISQPTTGNVVQVPSSLPQNNNQSTAAVTTFAQERQIRFSQGQQLVTKLVTAP
VACGAVMVPSTMFMGQVVTAYPTFAAQQQQPQTLSVTQQQQQQQQQQQSQQDQQQQVTTV
QQPAQPQLTQHPQQLLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQQQQQ
QQLSRHRTDKMTDPSKVQPQ
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgttttttaccataagcacccataaaatgagctccattgcagacagaaatgatggaagc
atttttgatgggctggtggaagaagatgacaaagataaagcaaaaagagtgtctagaaac
aagtctgaaaagaaacgtcgagatcagtttaatgtacttatcaaagagctgggttccatg
cttccaggcaatgctcggaagatggataaatccactgtactgcagaagagcattgacttt
ttacggaagcacaaagaaattactgcacaatcagatgccagtgagattcgacaggactgg
aaaccgacattccttagtaatgaagagttcacacagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaatataatatatgtgtcagaaagtataactccc
ttacttgaacatttgccatctgatcttgtggatcagagtgtatttaattttatcccagag
ggggaacattcagaaatttataaaatactgtcttctcatctgctggaaactgattcgttg
acaccagaatacttaaaatcaaaaaatcagctagaattctgttgccatatgctgcgagga
acaatagacccaaaagagcaacctacatatgaatatgtaaaatttataggaaatttcaag
tgtttgaataatgttcccaactcagcacacaacggttttgaaggaactattcagcgatca
caccggccttcatatgaagacaaagtttgctttgtagccacagttagattagctacacct
cagtttatcaaggaaatgtgcactgttgaagaaccgaacgaagagttcacatctagacat
agcttagaatggaagttcctattcttggatcacagggcacctccaataataggttatctt
ccgtttgaagttttgggaacatcaggctatgattattatcatgtggatgatctagataat
ctggcaaaatgtcacgagcatttaatgcaatatgggaaagggaaatcgtgttattataga
ttccttacaaagggacagcagtggatttggcttcagacacattactatatcacgtatcac
cagtggaattccaggccagagtttattgtctgtacacacactgttgtaagttatgcagaa
gttagagcagaaagacggcgagaacttggtattgaggagtctcttccagagataaaaacg
gataaaagtcaggactctggatctgacaatcacataaacacagtgagtctcaaagaagca
ctggaaaggtttgataccagccccacaccatctgcttcctccagaagttcaagaaaatct
tcacatactgcagtatcagatcattcatcaacaccaactaaaatgacagtggacactagc
actcctccaaggcaaagcttatctgctcatgaaaagtctacacaaagaagatcatctctg
agtagtcagtctttaagctcccagtctcttggacaaccagtaacacaaccaacagtgtct
cagcctgcaactttacagctccagtccaacgtgtcccagccagtgtttcagttttcagct
caattaggagctatgcagcatctaaaggaccagctagagcaaagaacacgcatgatagag
gcaaatattcatcggcagcaggaagagttgcgtaagattcaagaacagcttcaaattgtc
cacggtcaaggactccagatgtttttgcagcagtcagcttctggactcaacttcagttct
gtgcagcttacttctggaaattcttcaaatgttcagcaacttgcaccaataaacatgcaa
ggtcaagttgttcagagtaatcagactcaaagtgggatgaacacgggccatacaagtaca
ccgcacatgatacagcaacagcctttgcagagtactgcgtcacagcataatcaacaaaat
gtacttagtggacacagtcaacagtcttctcttgccagtcagtcacagagcacagtgtcg
gcacctttgtataacactatggtgatttctcagccaacaacaggaaacgtggtccaggtt
ccttctagcttgccacagaacaataaccagagtactgctgcagtaactacttttgcgcag
gagagacaaatcagattttctcaaggtcagcaactggtaacaaaacttgtcacagccccg
gtagcatgtggagcggtgatggtaccgagcactatgtttatgggacaggtggtgacagct
tatcccacttttgctgcccaacagcagcagccacagactttgtctgtaacacagcaacag
cagcagcaacaacagcagcagcaaagtcagcaagaccagcagcagcaggtcaccacagtt
cagcaaccagctcagccacagctgacccagcacccacaacagctcctacagacatccagg
ttacttcatggaaatcagtcagctcagcttatcctctctgctgctttcccactacaacaa
agcacttttactcagtcccaccaccagcagcatcaatctcagcagcagcagcagcagcag
cagcaactttcacgacacagaactgacaagatgactgatccttccaaagttcagccacaa
tag

DBGET integrated database retrieval system