KEGG   Anas platyrhynchos (mallard): 101798098
Entry
101798098         CDS       T02816                                 

Gene name
ARNTL
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor nuclear translocator-like protein 1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101798098 (ARNTL)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101798098 (ARNTL)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 101798098
NCBI-ProteinID: XP_027318045
Ensembl: ENSAPLG00000003885
Position
7
AA seq 633 aa
MADQRMDISSTISDFMSPDPADLISSSLSTSGVDCNRKRKGSSTDYQLDGFPFEEGMDTD
KDDQHGRLEYTDQQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDVT
PGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKVDRKSFCTIHSTGYLKSWPP
TKVGLDEDNEPDNEGCNLSCLVAIGRLHPHVVPQPVNGEIRVKPTEYVSRHAIDGKFVFV
DQRATAILAYLPXELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVSTSVLDSGDAAFPQLAASPHSMDSMLQAGEGG
PKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDTS
SPGNKKILNGGTPDISSAGLLSGQIQDSSGYPYSDNSSILGENSHIGIDMIDNDQGSSSP
SNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggcagaccaaaggatggacatttcttctaccattagcgattttatgtcaccggaccct
gctgacttgatctccagttcccttagcacttcaggagtggattgtaataggaaaaggaag
ggaagctctactgattatcaacttgatggctttccttttgaggaaggtatggatacagat
aaagatgaccaacatggcagattggagtatacagaccaacaaggcagaataaaaaatgca
agggaggcacatagtcaaattgaaaaaagacgtagagataaaatgaacagctttatagat
gaactggcatctttggtaccaacgtgcaacgcgatgtctcgaaagctggataagctcact
gtattgagaatggctgtccagcatatgaaaacattacgtggtgctacaaacccatataca
gaagccaactataagcctgcttttctatcagatgatgaattaaaacatcttattctcagg
gcagcagatggatttctttttgttgtgggctgtgacagagggaagatactgtttgtttca
gaatctgtcttcaagatcctcaactacagtcagaatgatttgattggtcaaagtttattt
gattaccttcatcctaaagacattgccaaagtgaaggagcagctctcctcttctgacact
gcaccacgagaaaggcttatagatgcaaaaactggactcccagttaaaactgatgtaacg
cctgggccatcaagactatgttctggagcaagacggtccttcttttgtaggatgaagtgc
aatagaccttcagtgaaagtagaagacaaggattttccttcaacctgttcaaagaagaaa
gtggatcgcaaaagcttttgcactatccatagtacaggttatttaaaaagctggccacca
acaaaagtgggactagatgaagataatgaaccagataatgagggttgtaatttaagctgt
cttgttgcaattggacggctgcatcctcatgtagtaccacagccggtcaacggtgagatc
agggtgaaacctacagaatatgtttctcgacatgcgatagatggaaagtttgtttttgta
gatcagagggcaacagccatcctggcttacttacccnaggaacttctaggtacttcatgt
tatgaatattttcatcaagatgatataggacatcttgcagaatgtcatagacaagttttg
cagacaagagaaaaaattacaactaactgctataagtttaaaataaaagatgggtctttt
attacattgaggagtcgctggttcagtttcatgaacccttggaccaaagaagtagaatac
atcgtctcaacaaatacagttgtttccaccagcgttcttgatagtggagacgcggccttt
ccacagcttgcagcttctccacatagcatggacagtatgcttcaggctggagaaggtggc
ccaaaaaggacccatcctactgtccctggcattccaggtggaacaagagctggggcagga
aaaatagggaggatgattgctgaagagatcatggagattcacaggataagaggatcatca
ccgtctagctgtggttcaagtccactgaacattaccagcacaccaccacctgatacatcc
tccccaggaaacaagaagatcctgaatggtggcactccagacatttcttcagccgggtta
ctatctgggcaaatccaagacagctctggttacccatattctgacaactcctctattctt
ggggagaactcgcatataggcattgacatgattgacaacgatcaaggatcaagcagccct
agcaatgatgaagcagcaatggcagtaatcatgagccttcttgaagcagatgcaggtctt
ggtggccctgtggattttagtgatttgccatggcccttgtaa

DBGET integrated database retrieval system