KEGG   Anas platyrhynchos (mallard): 101798303Help
Entry
101798303         CDS       T02816                                 

Gene name
QDPR
Definition
(RefSeq) LOW QUALITY PROTEIN: dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00790  Folate biosynthesis
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101798303 (QDPR)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     101798303 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Peptidase_S66
Motif
Other DBs
NCBI-GeneID: 101798303
NCBI-ProteinID: XP_027313143
Ensembl: ENSAPLG00000007721
Position
4
AA seq 246 aa AA seqDB search
MAAAGRVLVYGGRGALGSQCVQYFKARNWWVASIDLAENEDANANVVVRTTESFPEQAEQ
VTAEIGKLLGEEKVDAILCVAGGWAGGSAKAKSLYKNCDDVETXXXXLMWKQSVWTSTIS
SHLATKHLKEGGLLTLTGAQAALSGTPGMIGYGMAKGAVHQLCQSLAGTNSGLPSGSAAV
AVLPVTLDTPANRKSMPDADFSSWTSLEFIAETFYDWITGKNRPNSGSLIQVITTGGKTE
LVPAHL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgggcagggtgctggtgtacgggggcagaggggctctgggctcgcagtgc
gtgcagtacttcaaggccaggaactggtgggtcgccagcatcgacctggccgagaacgag
gacgccaacgccaacgtggtggtgaggacgactgagtccttccccgagcaggccgagcag
gtgacagcagagattgggaagcttcttggtgaagaaaaggtggatgcgatcctgtgtgta
gcaggaggatgggctggaggcagtgccaaagctaaatctttgtacaaaaactgtgatgat
gtggaaacagnnnnnnnnnntctgatgtggaaacagagtgtttggacatccactatttcc
agtcacctagccacaaagcatctgaaggaaggaggtcttctgactctgacaggagctcaa
gctgctttatctggaactccaggaatgattggctatggcatggccaaaggagcagtgcac
cagctttgtcagagtttggctggtaccaatagtggattgccatctggttccgctgctgtt
gctgttttaccggttaccttggatacaccagcaaacaggaaatcaatgcctgacgcagat
ttcagctcctggacatccttagaattcattgctgaaaccttttatgattggataacagga
aagaatcgaccaaattcagggagtctaatccaggtgataactacgggagggaagactgaa
ctagttccagcacatctttga

DBGET integrated database retrieval system