KEGG   Anas platyrhynchos (mallard): 101798501Help
Entry
101798501         CDS       T02816                                 

Gene name
MINPP1
Definition
(RefSeq) LOW QUALITY PROTEIN: multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00010  Glycolysis / Gluconeogenesis
apla00562  Inositol phosphate metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101798501 (MINPP1)
   00562 Inositol phosphate metabolism
    101798501 (MINPP1)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101798501 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101798501 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1 DUF4708
Motif
Other DBs
NCBI-GeneID: 101798501
NCBI-ProteinID: XP_027316006
Ensembl: ENSAPLG00000002470
Position
6
AA seq 459 aa AA seqDB search
MAPRRAAACLLPLLLAAAASAGLGGYFGTKSRYEEVNPHLVEDPLSLGPVAAGARLPAAC
APLQLRALLRHGTRYPTAGQIRRLAELHGRLRRRXRPPPXXXAAACPAAAALAAWQMWYE
ESLDGRLAPQGRRDMEHLARRLAARFPALFAARRRLALASSSKHRCLQSGAAFRRGLGPS
LSLGGDEAEIEVNDALMRFFDRCDKFIALVEENETAMHQVNAFKEGPEMRKVLEKVASAL
CLPVEELNADLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKILEYLNDLKQYWKRGYGY
DINSRSSCILFQDIFQQLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGFFKDDEP
LRANNYIRQAHRKFRTGRIVPYAANLVFVLYHCDQVKTSKEEYQVQMLLNEKLMPFHHSN
ETISTYADFKDYYKDILQNCHFKEVCELPKVNITAIDEL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgccgcgctgccgcctgcctcctgccgctgctgctggccgcggcggcgagc
gcggggctgggcggctacttcggcaccaagtcccgctacgaggaggtgaacccgcacctg
gtggaggacccgctgtccctggggcccgtcgccgccggggcgcggctgcccgccgcctgc
gccccgctgcagctccgcgccctgctccgccacggcacccgctacccgacggccgggcag
atccgccgcctggccgagctgcacggccgcctccgccgccgcnnccggccgccgccnnnn
nnnnnngccgccgcctgccccgccgccgccgccctggccgcctggcagatgtggtacgag
gagagcctcgacgggcggctggcgccgcagggccgccgcgacatggagcacctggcccgc
cgcctggccgcccgcttccccgcgctcttcgccgcccgccgccgcctggcgctggccagc
agctccaagcaccgctgcctgcagagcggcgccgccttccgccgcggcctcgggccgtcc
ctcagcctcggcggcgacgaggcggagatcgaggtgaacgatgccttgatgaggtttttc
gatcgctgcgacaagttcatcgccttggtggaggagaacgagacggcgatgcaccaagtg
aacgccttcaaagaggggcctgagatgaggaaggttttggaaaaggtagcaagtgccttg
tgtttgccggtggaggagctaaacgcagatcttgttcaagtggcttttctcacctgctca
tatgagttggccataaaaaatgtgacctccccatggtgttcgctcttcagtgaagaggat
gccaagatactggaatacttgaatgacctgaagcaatactggaagagaggatatggctat
gacatcaacagtcgctccagctgcattttattccaagatatcttccagcagttggacaaa
gcggtggaagagagcaaaagttcaaaacccatttcttcacctttgattgtacaagttggg
catgcagagacccttcaaccactgcttgctcttatgggtttcttcaaagatgacgagcct
ctcagggcaaacaattacatcaggcaagcacaccggaaatttcgcactggccggattgtg
ccttatgcagccaacctggtgtttgtgctttaccactgtgatcaagtgaaaacctctaag
gaggagtatcaagtgcagatgttgttgaatgaaaagctgatgccgtttcatcactcaaat
gaaaccatctctacttatgcagacttcaaggactattacaaggacatccttcaaaactgt
cacttcaaagaagtgtgtgagttgccaaaggttaatattactgccattgacgaactttga

DBGET integrated database retrieval system