KEGG   Anas platyrhynchos (mallard): 101798730
Entry
101798730         CDS       T02816                                 

Gene name
NPAS2
Definition
(RefSeq) neuronal PAS domain-containing protein 2 isoform X1
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101798730 (NPAS2)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101798730 (NPAS2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 101798730
NCBI-ProteinID: XP_027301822
Ensembl: ENSAPLG00000016315
Position
1
AA seq 817 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEISEIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTGGSIIYVSDSITPLLGHL
PCDVLDQNLLNFLPEQEHSEIYKMLSSCMLMTDSASSDYLKTDNELEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYSNVPNSTCNGFDDAVPRAYRTSPGKQICFVATVRLATPQFLKE
MCIVEEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
EHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHMVVSYADVRVER
RQEMGLEEVSSEVVSSALKDSGSSLDPEQHFNALDIGASILSASRTPSVSSRSSPKSSHT
PKSDPASTPTKLTAEASTPLQRTPSTQQDLSAHRLSQPTALQASLPSQPSCELLPQQLLP
QATLPSQPAPLAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELQKIQEQLCLVQDSS
VQMFLQQPTVSLSFSNIQQPEPQQLQQRPGVISQQQLVPSPQLPGQIASPQTPNQQVLRE
ASVISSQGPKAVRSTELAPGGGRPLRASAPTFGPATAPAAPPPRRGPGPGPGPPAAGCSH
DQQLRLLLSQPIQPMMPGSCNARHPSDLSMAGSQAKYSQNQQMFQSLEVQTSSSGSPIVL
MGQAVLNQGFATTPPSQPPSLPPMQLQHQQHQQQRYLQVQTPSPLHNEQTDSLLLPSYSP
QQGNMGYHQAQQQQQQQQRPRRSNSLSESSNLPQPLR
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaagacagggcaaagagggcttcgcgtaacaagtctgagaagaag
aggcgtgatcagttcaatgttctcatcaaagagctcagctccatgcttccaggcaacacc
cgcaaaatggacaaaactactgtgctggaaaaagtcattggctttctgcagaaacacaat
gaagtctcggcacagacggagatttctgaaattcagcaggactggaagccttcattcctc
agcaatgaagaattcacccagctgatgttggaggcattagatggcttcatcatcgcagta
accacaggtgggagcatcatctacgtgtctgacagcattactcctcttctagggcacttg
ccgtgtgatgtcttggatcaaaatttgttaaacttcctcccggaacaagaacattcagaa
atttataagatgttatcttcctgtatgcttatgacagattctgcctcatcggattaccta
aaaactgacaatgaactggagttttattgtcatcttctgagaggaagtttgaacccaaag
gaatttccaacatatgaatacataaaatttgtaggaaactttcggtcttacagcaatgtg
cctaactccacctgcaatggcttcgatgatgctgtcccgagggcttaccgaacatcacca
ggaaagcagatctgctttgtcgctaccgttcgtttggcaacgcctcagtttttaaaggag
atgtgcatcgtggaagaacctttagaggaattcacgtcaagacacagtctggaatggaaa
tttttattcctggatcacagagcaccgccgattataggatacttgccttttgaagtgctg
ggtacttctggctatgactattaccatatagatgacctagagctgctcgcaaggtgccac
gaacacttgatgcagtttggcaaggggaagtcgtgttgctatcggtttctgaccaaagga
cagcagtggatctggctccagacccattactacatcacgtaccaccagtggaactccaag
ccagagttcattgtgtgcacacacatggtggtaagttacgcagatgttcgggtagagcgg
agacaggagatgggcttggaagaagtgtcctcagaggtcgtgtcctcagcactaaaggac
agtggctccagcttggatcctgaacagcactttaatgcactcgatattggtgcctcaatc
ctcagtgctagccggacaccctcggtgtcatccaggagctcaccaaaatcttcccacaca
cccaagtcagacccagcgtctacgccaacaaagctgactgcagaggctagcacccccttg
caaaggacacccagcacgcagcaggacttatctgcacacagactcagccaacctactgcc
ctgcaggcttctttgccttctcagccttcatgtgagcttcttccacagcagttgctgcct
caagcaactttgccaagtcagcctgcaccactggcacagttctcggcacagtttagcatg
ttccagaccatcaaggaccagctagagcagcgaacgcggatcctgcaggccaacatccgc
tggcagcaggaggagctgcagaagatacaggagcagctctgcctggtccaggactccagc
gtgcagatgttcctacagcagccaacggtgtccctgagctttagcaatatccagcagcca
gagccacagcagctacagcagaggccaggggtcatttctcagcagcagcttgtccccagt
cctcagctccccgggcaaattgcatctccacaaacaccaaatcagcaagtactgagagaa
gcaagtgtgatatcgagccagggcccaaaggcggtgaggagcacggagctggcaccgggt
ggtggccgtcctctccgtgcctcggccccaacgtttggccccgccacggcccctgcagcc
ccaccaccccgccgtggccccggccctggccctggcccacccgccgccggctgcagccat
gaccagcagctcagactgttgctcagccaacccattcagccaatgatgcccgggtcctgt
aatgcaagacacccttcagacctcagcatggctggatcccaggctaaatactctcaaaac
caacaaatgtttcaaagtttggaagtgcagacttccagcagcggctctccaatcgttctg
atgggacaagcagtgttaaaccaagggtttgccacgacacctccttcccagccaccctct
ctgccacctatgcaactccagcaccaacagcatcagcaacaacgctacctgcaggtgcaa
acaccaagtcctttgcacaatgagcaaaccgattctttgctcctgccatcttactcacca
cagcaagggaacatggggtatcatcaggcacagcagcagcagcagcagcagcagcgacca
agaagaagcaatagcttatcagaatcatcaaatttaccacagccactgcgataa

DBGET integrated database retrieval system