KEGG   Anas platyrhynchos (mallard): 101799011Help
Entry
101799011         CDS       T02816                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X5
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04012  ErbB signaling pathway
apla04068  FoxO signaling pathway
apla04137  Mitophagy - animal
apla04140  Autophagy - animal
apla04141  Protein processing in endoplasmic reticulum
apla04210  Apoptosis
apla04217  Necroptosis
apla04310  Wnt signaling pathway
apla04510  Focal adhesion
apla04530  Tight junction
apla04620  Toll-like receptor signaling pathway
apla04621  NOD-like receptor signaling pathway
apla04622  RIG-I-like receptor signaling pathway
apla04625  C-type lectin receptor signaling pathway
apla04910  Insulin signaling pathway
apla04912  GnRH signaling pathway
apla04914  Progesterone-mediated oocyte maturation
apla04920  Adipocytokine signaling pathway
apla04933  AGE-RAGE signaling pathway in diabetic complications
apla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101799011 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101799011 (MAPK9)
   04012 ErbB signaling pathway
    101799011 (MAPK9)
   04310 Wnt signaling pathway
    101799011 (MAPK9)
   04068 FoxO signaling pathway
    101799011 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101799011 (MAPK9)
   04137 Mitophagy - animal
    101799011 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    101799011 (MAPK9)
   04217 Necroptosis
    101799011 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101799011 (MAPK9)
   04530 Tight junction
    101799011 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101799011 (MAPK9)
   04621 NOD-like receptor signaling pathway
    101799011 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    101799011 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    101799011 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101799011 (MAPK9)
   04920 Adipocytokine signaling pathway
    101799011 (MAPK9)
   04912 GnRH signaling pathway
    101799011 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    101799011 (MAPK9)
  09158 Development and regeneration
   04361 Axon regeneration
    101799011 (MAPK9)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101799011 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101799011 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    101799011 (MAPK9)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101799011 (MAPK9)
Protein kinases [BR:apla01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101799011 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 101799011
NCBI-ProteinID: XP_021132210
Ensembl: ENSAPLG00000013460
Position
14
AA seq 317 aa AA seqDB search
MELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKI
LDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQG
TDHIDQWNKVIEQLGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRD
KLKTSQARDLLSKMLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREH
AIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVNSNTSPSQSSSINDISSMSTEQTLAS
DTDSSLDALTGPLEGCR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggagctgatggatgccaatttgtgccaagttattcatatggaattggatcatgaaaga
atgtcctatcttctttaccagatgctatgtggtatcaaacatcttcactcagctggtatc
atccacagagatttgaaacccagcaacatagtagtaaaatcagattgtacgctcaaaatc
cttgattttggactggcaagaacagcgtgtactaattttatgatgactccatatgtagta
acacggtattatagagcaccagaggttatccttggaatgggctataaagaaaatgttgat
atctggtcagttgggtgcatcatgggagaattggtgaaaggttgtgtgattttccaaggc
actgatcatattgatcagtggaataaagttattgaacaattaggaacgccgtcagcggac
ttcatgaagaaactacagcctacagtgaggaattatgtagaaaacaggcccaaatatcct
ggtattaaatttgaagagctcttcccagactggatatttccatcagaatctgatcgtgac
aagttaaaaaccagccaagctagagatttattatcaaaaatgcttgtagtagatccagac
aagagaatttctgtagatgaagccttacgtcatccttatattactgtctggtatgaccca
gctgaagcagaagctcctccaccccaaatctatgatgcacaattggaagaaagagaacat
gcaattgaagaatggaaagagttaatatacaaagaagtaatggattgggaagaaaggagc
aagaatggtgtggtaaaagatcagccctcagatgcagcagtgaatagcaacaccagtcct
tcccagtcatcatctatcaatgacatttcatccatgtcaacagagcaaacattggcttca
gatacagacagcagcctcgatgccttgacaggaccccttgaaggatgccgatga

DBGET integrated database retrieval system