KEGG   Anas platyrhynchos (mallard): 101799251Help
Entry
101799251         CDS       T02816                                 

Gene name
GPX8
Definition
(RefSeq) probable glutathione peroxidase 8 isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00480  Glutathione metabolism
apla00590  Arachidonic acid metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101799251 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101799251 (GPX8)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101799251 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 101799251
NCBI-ProteinID: XP_005019922
Ensembl: ENSAPLG00000009098
UniProt: R0L669
Position
Z
AA seq 210 aa AA seqDB search
MEPLTTTYPLKYSVPKARVFVVFLSMVLCTAVLCILQLRFFKPKSKDFYSFEVKDSRGRI
VSLEKYRGKATLVVNVASYCQNTDKNYIALQELHREFGPSHFTVLAFPCNQFGESEPGSS
QEIEAFAKGNYGVTFPVFHKIKILGSEAEPAFKFLIDSSKKEPRWNFWKYLVSPEGKVVK
FWRPEEPIESIKPEVASLIRQIIMKKREDL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcacaactacttaccctctgaaatattcagtgcccaaagccagggtcttt
gtcgtttttctgtcgatggttttgtgtactgcagttctctgcatactgcaactcagattt
tttaaacctaaatccaaagatttttattctttcgaagtcaaggattcacgaggaaggatc
gtttcattggagaagtacagagggaaagcaactttggttgtaaacgtggcgagttactgc
cagaacacagacaaaaactacatcgccctgcaagagctacacagggagtttggtccctcc
cacttcactgtgctggcctttccctgcaaccagttcggagaatcagagcccggctcaagc
caggaaatagaggcttttgccaaaggaaactatggagtaactttccctgttttccacaaa
atcaagatcctgggatcagaagcagagcccgcgtttaaatttctaatagattcttcaaag
aaagagcctcggtggaatttctggaagtacttggtcagtcctgagggtaaagttgtgaaa
ttctggagacctgaagagcccatagaaagtatcaagccagaagtagcatcattaatcagg
caaatcatcatgaaaaaaagagaagacctttga

DBGET integrated database retrieval system