KEGG   Anas platyrhynchos (mallard): 101799516Help
Entry
101799516         CDS       T02816                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101799516
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:apla04030]
    101799516
G protein-coupled receptors [BR:apla04030]
 Rhodopsin family
  Lipid
   Leukotriene
    101799516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 101799516
NCBI-ProteinID: XP_005028729
Position
17
AA seq 369 aa AA seqDB search
MSTPSSNGTATPIPSAAVGLTLLSAAMVIGLPGNALVLWSCAATRRRGIPMLLVFHLALA
DVATLLTGPVYIRFLSTGRWDLGLAACRGCNYICAAAMYASVFLIALLGLHRCLVVSRPS
AAVVVGDRAAQLAHGAAAVTWLVALILATPSIAFRHVEDGHCKRKHSSTAWLVTHNLLET
GLGWALPLTAVAAGYGLLLQRLRRTRLARRGRTLGLVAAVVVAFAVTWGPYHIASLLEVV
AKLQKGNEPLNRVARAIRPPATALAFLSSALNPLLYACAGRGLCHTAGTALLPRLLEGST
VFHSSRKTTARATHQARTTQKDKEKGCQDVTVEDTGTGDGGAAVEIMGMGDVGTVVEDTE
TGDSGIGRA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaccctcctccaatgggacagccacccccatccccagcgcagcagtgggactg
accctcctgtccgcagcgatggtcatagggctgccagggaatgcccttgtgttgtggagc
tgcgcagccacccgtcgccgtggcatccccatgctgctggtgttccacctggctctggcc
gatgtggccaccctcctaaccggccctgtctatatccgcttcctgagcaccggtcgctgg
gacctgggcctggctgcttgccgtggctgcaactacatctgtgctgccgccatgtatgcc
agcgtcttcctcatcgccctgcttggcctgcaccgctgcctggtggtgtcccggccatcg
gcggcagtagtggtgggtgaccgcgctgcccaactggcccatggggccgcggcagtcacc
tggctggtggcgttgatactggctactccctctatcgccttccggcatgtggaggatggg
cactgcaagcggaaacacagctccactgcttggctggtgactcacaacctgctggagaca
gggctgggctgggccctgccactgactgctgtggctgctggctatgggctgttgctgcag
cggctgcggcgcacacgactggcacggcggggccgcacgctggggcttgtggccgctgtg
gtggtcgccttcgctgtcacctggggaccctaccacatcgccagcctgctggaggtggtg
gcaaagctgcagaagggcaatgagcccctgaacagggtcgccagggccatccgcccacca
gccactgccctggccttcctcagcagtgccttaaaccccctgctctacgcctgtgctggc
cgggggctgtgccacactgctgggactgctctcctgccccggcttctggagggctccacg
gttttccacagctcccgtaagaccacggccagggccacccaccaggcaaggaccacacag
aaagacaaggaaaaggggtgccaggatgtgacagtggaggacacagggacaggggatggg
ggagcagcagtggaaatcatggggatgggggatgtggggacagtagtggaggacacagag
acaggggacagtgggataggaagggcatga

DBGET integrated database retrieval system