KEGG   Anas platyrhynchos (mallard): 101799591
Entry
101799591         CDS       T02816                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00230  Purine metabolism
apla00240  Pyrimidine metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101799591 (DCK)
   00240 Pyrimidine metabolism
    101799591 (DCK)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101799591 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 AAA_33 Thymidylate_kin BCAS3
Other DBs
NCBI-GeneID: 101799591
NCBI-ProteinID: XP_027311860
Ensembl: ENSAPLG00000012557
Position
4
AA seq 257 aa
MATPPKRGRLEGRVKKIAVEGNIAAGKSTFVNILKQADEEWEVVHEPVARWCNVQQNSED
DCEELTASQKSGGNVLRMMYDKPERWSFTFQTYACLSRIRAQIKSLEGKLREAENPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNRQFGQSLVLDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFEFLQEIPILTLDVNEDFKGKK
DRYDHMTEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcgactccccccaagcgcgggcggctggagggcagggtgaagaagatcgccgtggag
ggcaacatcgctgcagggaagtcaacgtttgtgaatatcctcaaacaagctgatgaagaa
tgggaagttgttcatgagcctgtagctagatggtgcaatgttcaacaaaattcggaagat
gattgtgaggagctgactgcatcacagaagagcggtggaaatgtgcttcggatgatgtat
gacaaaccggagaggtggtctttcactttccagacctacgcctgcctcagcagaattcgg
gctcaaatcaaatcccttgaaggcaaactcagagaggcagagaatcctgtggtcttcttc
gaacgatccgtctacagcgacagatatatctttgcagctaatttatatgagtctgattgc
atgaatgaaacagaatggactatttaccaagactggcatgactggatgaataggcagttc
ggtcaaagcctagtgctggacgggatcatttatctcagagccactcctgagaaatgctta
aataggatttacttgcgtggaagagatgaagaacaagaaattcccatcgaatatctggag
aagcttcactacaagcatgaaagctggcttcagcataggacactgcgaacggattttgaa
tttctacaggaaatacctatcttaacattagatgttaatgaagacttcaaaggcaaaaag
gacagatatgatcacatgactgaaaaggtgaaggaatttttgagcacattataa

DBGET integrated database retrieval system