KEGG   Anas platyrhynchos (mallard): 101800109
Entry
101800109         CDS       T02816                                 

Gene name
AHR
Definition
(RefSeq) aryl hydrocarbon receptor isoform X2
  KO
K09093  aryl hydrocarbon receptor
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101800109 (AHR)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101800109 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 101800109
NCBI-ProteinID: XP_005015196
Ensembl: ENSAPLG00000008769
Position
2
AA seq 756 aa
MQILEGELLLQALNGFVLVVTADALVFYVSSTIQDYLGFQQSDIIHQSVFELIHTEDRPE
FQRQLHWALNPSQSADSGPSVQGDNGFSQPATYYNPDQLPPENSSFMERNFICRLRCLLD
NSSGFLAMNFQGWLKFLHGQNKKGKDGTTLSPQLALFAVATPLQPPSILEIRTKNFIFRT
KHKLDFTPTGCDAKGKIVLGYTEAELCMRGTGYQFVHAADMLYCAENHVRMMKTGESGMT
VFRLLTKENRWAWVQANARLVYKNGRPDYIIATQRPLTDEEGAEHLRKRNMKLPFMFATG
EAVLYEVTFPMSSLMDASQPRNKATTGKGGKATLHGDSVDPNSILGAMLRQDESVYLCPP
ASHKLSFERNFFTDSRDELGSVVSSDWTDSFLPAGNHSILKQELTECSQDSSVPLPEDSA
ALFQDNKTSDLYSIMKNLGIDFEDLKYIQQDEDFFKTELSGMDDIGDIDITDEILTYVQD
SLNKSDFLYSGCNQQQPVVQNANCLVQQELDQHQIHEHRKQLMEQQQQQQQQQQQQQLCQ
KMKHMQVNGMLTNWNSGTSMPLSCSQQQPQQYVFSGMHATTPEFSYKSEVNTSPYACRQE
FVPYKQPTAMMPQLSNFSQMNFPVASFERSTYSASSNLEDFLGCLQQVPENHDCAINSES
VMLTPQTCYAGAVSMYQCTQEAQPSCMDQMQYDPMMASQQTLLNKFQNGFNGGNVNEAYP
SQLDVISNAQTATHLQPLHHPTEPRSFSDLASSGFM
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgcagatcctcgaaggggaactcttactgcaggcattaaatggttttgtgttagttgtg
acagcagacgctctggttttttacgtctcttctactatccaagactacctggggttccaa
caatctgatattatacaccagagtgtatttgaactgattcacacagaagacagacctgag
tttcaacgtcagctacattgggcattaaatccttctcagtctgcagattctggaccaagt
gtacaaggagataatggcttttcacagccagcaacctattataacccagaccaacttcct
ccagagaattcttcctttatggaaaggaatttcatctgcaggttacgatgcctcctggat
aattcatctgggttcctggcaatgaattttcaaggatggttaaagtttctccatggacaa
aacaagaaagggaaggatggcactactttgtctcctcagctagctttgtttgcagtagct
actcccctgcagccaccatctatccttgagatacgaaccaaaaacttcatcttcagaaca
aaacacaagctggatttcacacctacgggctgtgatgcaaaaggaaagattgtcctggga
tacactgaagcagagctgtgtatgagaggaacgggataccagtttgttcatgcagctgat
atgctttattgtgctgaaaatcatgtccgaatgatgaagacaggtgaaagtggaatgact
gtcttcaggcttctaaccaaagaaaatcggtgggcctgggtacaggcaaatgcgcgactt
gtgtacaaaaatggaagaccagattacatcattgccacgcaaagacctcttacagacgaa
gaaggggcagaacatctacggaaacgtaacatgaaactgcccttcatgtttgccacgggt
gaggctgttttatatgaggtaactttcccaatgtcaagccttatggatgcttctcagcca
aggaataaggccacaacgggaaaaggaggtaaagctacgctacacggtgattctgtggat
ccaaactccattctaggtgccatgttaaggcaagacgagtctgtgtatctttgccctcca
gcatcacacaaactttcctttgagaggaacttcttcacagacagcagggacgaactgggc
agtgttgtaagcagtgactggacggatagtttcctgcctgctggaaatcacagcatcctg
aaacaggaactaactgagtgttcccaggacagtagtgtgccgcttcctgaagacagtgcg
gcactctttcaagataacaaaaccagtgatttgtacagcatcatgaaaaatcttggtatt
gactttgaagatctaaagtacattcagcaggatgaggatttttttaaaactgaattatct
ggtatggatgatattggggacatagacataactgatgaaatcctgacttatgttcaggat
tccttaaataagtctgacttcttatattcaggctgtaaccagcagcaacctgtggtccag
aatgccaattgcttggtacagcaagaattagatcagcatcaaattcatgagcatcggaag
cagctcatggagcagcagcaacagcagcagcagcaacagcagcagcagcagctctgtcag
aagatgaaacatatgcaagtcaacgggatgctaacaaattggaactctggcaccagcatg
cctcttagctgctcacagcagcagccccagcaatatgtattctctggcatgcatgccaca
actcctgagttttcttacaaatcagaagtaaacacttcgccttatgcatgtaggcaagag
tttgttccttataagcaacccacagcaatgatgccgcagctttctaatttttcccaaatg
aatttccctgtagcaagttttgagagatcaacgtactctgcttcttccaacttggaagat
tttctcggttgtttgcagcaggtccctgaaaatcacgattgtgcgataaactctgagtcg
gttatgctaactcctcaaacatgctatgcaggtgctgtttctatgtaccagtgcacgcaa
gaagcacagcccagctgcatggatcaaatgcaatatgatcctatgatggcaagtcaacaa
acattgttgaacaagtttcaaaacggtttcaatggaggaaatgtaaatgaagcatatccc
tctcagttagatgtgatcagtaatgcacagactgccacacatcttcagcctcttcatcat
ccaacagaacccagatccttctcagatttggcatctagtggatttatgtaa

DBGET integrated database retrieval system