KEGG   Anas platyrhynchos (mallard): 101800142Help
Entry
101800142         CDS       T02816                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00511  Other glycan degradation
apla00600  Sphingolipid metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101800142
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101800142
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101800142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 101800142
NCBI-ProteinID: XP_027303851
Position
Unknown
AA seq 232 aa AA seqDB search
CLSGCPLGGIGGGTITLGKFCHWQLNPKKYHYGTIIADQFTLCLHCKGQTVYQQVLSVER
PSTLQGWNWGYCSHYAFYHGLYSRTWMVYELLGQNVVLTCHQVFLVIPYDYKDSSLPVGM
FIWEVENNNEEPVDISIVFSLQNAMGAKEDKSGEHWNEPFALQEGGKRVAGVLLHHCTPM
NPFTLAVASWEKVRASSGSRTVPLAGMLIVALGWGQPQSWVLCGVSSKRSCG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
tgtctgtcaggctgcccgctgggcgggattggtggaggcaccatcacgcttggcaagttc
tgccactggcagctgaaccccaagaaataccattatgggacgattatcgctgaccagttc
acactgtgcctgcattgcaaggggcagacagtttaccagcaggtcctgtctgtggagaga
cccagcacactgcagggctggaactggggctactgcagccactatgccttctaccatgga
ctgtactcccgcacctggatggtctacgagctgctggggcaaaacgtggtgctcacatgc
caccaggtctttctggtcatcccctatgattacaaggactccagcctgccggtgggaatg
ttcatctgggaagtggagaacaacaatgaggagcccgtggacatctccatcgtgttcagc
ctgcaaaatgccatgggtgcgaaggaggacaagagcggggagcactggaatgagcccttt
gccctgcaggagggtggcaagcgggtggctggtgtcctgctgcaccactgcacccccatg
aaccccttcacgcttgctgtggcttcctgggagaaggtgagggccagcagtgggtccagg
actgtgccactggcagggatgcttatagtggccctgggctggggacagccccagagctgg
gtgctgtgtggggtttctagtaagaggagctgtgggtga

DBGET integrated database retrieval system