KEGG   Anas platyrhynchos (mallard): 101800954
Entry
101800954         CDS       T02816                                 

Gene name
AKAP5
Definition
(RefSeq) LOW QUALITY PROTEIN: A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:apla01009]
    101800954 (AKAP5)
Protein phosphatases and associated proteins [BR:apla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101800954 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 101800954
NCBI-ProteinID: XP_027313824
Position
5
AA seq 568 aa
MAKAAKEIQMENPKELETQSAGTTCSPSEEQAEKPSMLCFKKRKKSCKKGLTVKDACEGA
SAASEEKSQCIGTDKGEAKVSAQPRSSRGAWAAIKSLTRPRRRQKSSSRKKVTSDSQVQL
EIDAEEGGTQGFSRKKASSGVKMPCVRFSRGKKKRSLSEAVEESEGSVQANEEMGISNKA
IEELEDLAPAEEPSKAEPSSPLPVEEAREDKGMIEEGADAGVKSEPLAEPRPDMDEHAEH
TTQSEITSSEAEAVDEHAEHTAQSQITSPEAEAVDEHTERTTQSQITSSEAVMNMQNTLL
SPITSPEAEAVDEHAEHTTPLKITSSEAADEHAEDTTQSEITSPVAVDEPIQEQLPEGSP
HQTAVHVEEREVPAEVPVSTEQPNNTPEITEVQEIANICKELPEGGESEENTNLPEESKA
EETVMDFSQSAFKDEAASVQSSSSNQEKPEINMGTCVGIVITVTEAVDSDNDSDQDYEPT
LVLHHNKQKGNKKSSGSFDLGQKGGPEAGSSALAEEKGLGDQGHRTSDQYELLLIETASS
LVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggcaaaggcagctaaggaaattcaaatggagaacccaaaagagctggagacccagagc
gcagggacaacgtgctccccgtcagaagaacaggcagaaaaaccctccatgctctgcttc
aagaagcggaagaagtcctgtaagaaggggctgaccgtgaaggatgcatgcgaaggagct
tctgcggcctcggaggagaaaagccagtgcatcggcacagacaaaggggaggcaaaagtt
tctgctcagccacgatcctccagaggagcctgggcagctattaaaagtctcacaagacct
cggagaaggcaaaaatcctcttcaaggaagaaggtgacctccgattcccaggtgcagctg
gagatagatgctgaggagggcggcacacaaggtttctcaaggaaaaaggcgagctcaggt
gtgaagatgccctgcgtacggttctcaagaggcaagaaaaagcgcagcctctctgaggca
gtggaggagtcagagggcagtgtccaggcgaatgaagagatgggcatttcgaataaagcc
attgaggagctggaggacctggccccagcagaggagccaagcaaagctgagccctccagc
ccactccctgtggaggaggcccgggaggacaagggtatgatagaggaaggggctgatgct
ggtgtgaagagtgagcccttggcagagcccaggcctgacatggatgaacacgcagagcac
accactcagtccgaaatcaccagctcggaggcagaggcagttgatgaacacgcagagcac
accgctcagtcccaaatcaccagtccagaggcagaggcagttgatgaacacacagagcgc
accactcagtcccaaatcaccagttcagaggcagtgatgaacatgcagaacacactactc
agtcccatcaccagtccggaggcagaggcagttgatgaacatgcagaacacaccactccg
ctgaaaatcaccagttcagaggcagctgatgaacacgcagaagacaccactcagtcagaa
atcaccagtccagtggcagttgatgaacccatccaggaacagctgcccgaggggagtcct
caccaaactgcagtgcacgtggaagagagggaagtccctgctgaagtgccggtttccaca
gagcagcccaacaacactcctgaaatcaccgaggtgcaggaaatagccaatatctgcaaa
gagctgcctgaagggggtgaatcagaggagaacacaaatcttcctgaggagtccaaagct
gaagagaccgtaatggatttcagtcagtcagcatttaaagatgaggcagcgagcgtgcag
agcagctccagcaaccaggagaaacctgaaatcaacatgggcacctgtgtcggtattgtc
attaccgtcactgaagctgtggactctgacaacgactctgaccaggactatgagccgacc
ctggttttgcaccacaataagcaaaaagggaataaaaagtcaagtgggagctttgatttg
ggtcaaaaagggggccccgaggctggcagcagtgccctggcggaggagaaaggcctgggt
gaccaggggcacaggacttcggatcagtacgagttgctcctcatagaaacggcgtcttcc
ctcgtgaaggcagccatccagtcatccatagagcagctggtcaacgagatggctctggaa
cagaacaaacacaacagtttcctgtga

DBGET integrated database retrieval system