KEGG   Anas platyrhynchos (mallard): 101801357
Entry
101801357         CDS       T02816                                 

Gene name
ARNT2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2 isoform X6
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101801357 (ARNT2)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101801357 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 101801357
NCBI-ProteinID: XP_012962019
Ensembl: ENSAPLG00000010837
Position
11
AA seq 735 aa
MASDIPGSVALPVAPMASGQVRMAGSMPSRGGKRRSGMDFDDEDGEGPSKFSRYDGDQIS
GDKEKFARWEDDQSTADTERMARENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDK
LTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIY
VSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEG
QQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRYRNGLGPVKEGEAQYAVVHC
TGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHN
SDGVITFVDPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYR
FRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLS
QVPVPSIPANVHEGGKSVEKPDAIFSQERDPRFAEMFAGITASDKKMMASASTAGNQQLY
SQGSPFQPGHSGKTFSSSVVHVPGVNDIQSSSSTGQNLTQISRQLNQSQVAWTGNRPPFP
GQQIPSQSGKAQSSPFGIGTSHSYPADPSSYSPLSSPATSSPSGNAYSSLANRSAGFAEG
GQSSGQFQGRPSEVWSQWQSQHHNQQSGDQHSHPQPSQTEVFQDMLPMPGDPTQGTGNYN
IEDFADLGMFPPFSE
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcatctgacattcctggctcggtggctttgccggtggcaccaatggcaagcggacag
gtgagaatggcaggatccatgccttccagaggaggaaagcgccgctctggaatggatttc
gatgatgaagatggggaagggcccagcaaattttcaaggtatgatggtgatcaaatctct
ggtgataaggaaaagtttgcaaggtgggaagatgatcaaagtactgctgacacagaaagg
atggccagggagaatcacagtgaaattgagaggcgccgaagaaataagatgacacagtac
atcaccgaactgtctgatatggtacccacttgtagtgcgttggctcgtaaacctgacaag
ctgacgattcttcggatggctgtttcacacatgaaatcaatgaggggcactggaaataaa
tctactgatggagcttacaagccttcgtttcttacagaacaggaactgaaacatcttatc
ctggaggctgcagatgggttcctgtttgtagttgcagctgagactggaagagtcatctac
gtatctgattctgtgactcctgtgctgaaccagcctcagtccgaatggtttggcagcact
ttgtacgagcaagttcacccagatgatgtggaaaagctacgggagcagctgtgtacatct
gaaaactctatgacaggacgaatcctggacttgaagactggaacagtaaagaaagagggt
cagcagtcctcaatgagaatgtgcatgggatcaagacgctctttcatttgcaggatgagg
tgtggaaatgctcctctggatcatttacctctgaacagaataaccaccatgagaaaaaga
tacaggaatggccttggcccagtaaaagaaggtgaagcacagtatgctgttgtccattgc
actggctatatcaaggcatggccaccagcaggaatgactataccagaagaagacgctgat
gtgggacaaggtagtaaatactgcctcgtggcaataggaaggcttcaggtaaccagctct
ccagtgtgcatggacatgaacggcatgtcggtcccaaccgagttcttgtcgaggcacaac
tctgacggagtcatcacgttcgtcgatcccaggtgcatcagtgtcattggctaccagccc
caggatcttctggggaaagacattttagaattctgccatcctgaagatcaaagccatttg
agagagagtttccaacaggttgtgaaactgaaaggtcaggtcctgtctgtgatgtatcgt
tttcgcaccaaaaaccgggagtggatgctgatcagaaccagcagcttcacgtttcagaat
ccttactctgacgagattgagtacatcatctgcaccaacaccaacgtgaaacaacttcag
caacagcaagcagaacttgaagtgcatcaaagagatgggctgtcatcctatgacttatca
caggtgcctgttccaagtataccagctaatgttcatgagggtggaaagtctgtggagaag
cctgatgctatcttctcccaggagagagatcctagatttgctgagatgtttgctggaata
actgcttcagataaaaaaatgatggcctcagcatccacagcaggaaaccagcagctttac
tcacagggaagcccatttcagccaggacattcaggaaagactttcagttcatctgtggta
catgtgcctggtgtgaacgacatccagtcttcttcatcaacaggccaaaatctgacacag
atatctcgccagctaaatcagagtcaggtggcctggacaggaaatcgcccaccatttcca
ggacagcaaattccgtctcagtctgggaaggctcagtcatctccatttgggattggaaca
agtcacagctacccagctgatccatcatcgtacagccctctttccagccctgccacctct
tctccaagtgggaatgcctactctagcttagcaaaccggagtgcagggtttgctgaaggt
ggccagagcagcggccagttccaggggagaccatccgaagtctggtcccagtggcagagc
cagcatcacaaccagcaaagtggggaccagcattcgcacccgcagcccagtcagacggag
gtgttccaggacatgctgccaatgccgggggatccgacgcagggtactggcaattacaac
attgaagattttgctgacctgggcatgtttccaccattttctgaatag

DBGET integrated database retrieval system