KEGG   Anas platyrhynchos (mallard): 101801580
Entry
101801580         CDS       T02816                                 

Gene name
PASD1
Definition
(RefSeq) circadian clock protein PASD1 isoform X1
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101801580 (PASD1)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101801580 (PASD1)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 101801580
NCBI-ProteinID: XP_012955943
Ensembl: ENSAPLG00000014933
Position
10
AA seq 829 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELCTMLQGHGHPLKMDKSTILQRTIDFLQK
QKEITAQTEACEIRQDWKPSFLSNEEFTQLMLEALDGFLIALTTDGIIIYVSDSVSSLLG
HLPSDLVDQNILNFLPEREQSEVYKLLSPHVLMTDPVAADFLNVEKQIEFCCHLARGSLD
PNEPLTYEYVKFVVDFKYFTHVPTPSCNGFESAIARAFRSATEEQICLVATVRLVTPQFL
KELCNVEEPCEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHADDLELLAR
CHEHLMQFGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHLVVSYAEVRA
ERRRDLGLEESSIELASSSVKSHSSYLDVGQCGSSQEASREGVSLSSHSSRRSSHTALSD
SASTSSMRHTDTSTPTRTAVPEKAALRLALAGGAQAIVTPPAPGEHLPQHPVAQPAVPSQ
HAVMPVYHFPAQLGMMHQLKEQLEERTRILQADIKTQQEELHVIKEQLQLVQDSNLQMLM
QQPVPLVFNNVQHQSPRRPPPPPRTPRQPSAKKSPQPGPMGTKHYGGPHVSSPRQFLREP
CGTSSQVPQQQHLMRGNQAQQTCLPGQTSISMPLYNNPMVFSQAHPITVAAQMPTDLSER
QPQSNYSQDRSLRMLLDQSIQAMMPAANGSAQATLSGTSRQQGKFVAEQQTLPPAVQMQP
ITCSTVRPPAPSPVFSPSVVIPHASFTSHQTSAPVHLHQWPQQQVQQHRLYLQMQSPEAV
PGGPSPRVFQPAHVAQQNPLSYFLHPQPQSRHAQGQACNLQDLPEMQLP
NT seq 2490 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaggacagggcaaagagggcatcacgcaacaaatctgaaaagaag
aggagagaccagttcaatgtcctcattaaagagctttgcacaatgctgcagggccacggc
caccctctcaagatggacaagtccaccatactgcagaggaccatcgacttcttacagaaa
cagaaagaaatcacagcacagacagaagcctgtgagattagacaagactggaagccttca
tttcttagcaacgaggagttcacccagttgatgttagaggcattagatggctttctcatc
gctcttaccactgatgggattattatttatgtatccgacagcgtctcctctctgctcgga
cacttaccgtcagatttggtggaccaaaatatattaaactttctgcctgagcgggaacag
agcgaggtctacaagctcctttctccacacgtgctcatgacagatcctgttgcagctgat
tttctcaatgtggaaaagcaaatagagttttgctgccatttagcaagaggcagcttagat
ccaaatgaacccctgacgtatgaatatgtgaaatttgtagtggattttaaatattttact
catgtgcctacaccctcctgtaatggctttgagtcagctattgcacgagctttcaggtca
gccacagaggagcagatttgcctcgtagcgactgttcgtctcgtcacaccgcagttctta
aaggagctttgcaatgttgaagagccatgcgaagaatttacatcaaggcatagcttggaa
tggaagtttttgttcttggaccacagggctccacccatcataggatacttaccctttgag
gttctgggaacgtcagggtacgactactaccatgcagatgacctggagcttctcgctagg
tgccatgaacacttgatgcagtttggaaaaggcaagtcgtgttactacaggttcctgacc
aaaggccagcagtggatctggctgcagacacactactacatcacctaccaccagtggaat
tccaagcccgagttcatcgtttgcactcacctggtagttagttatgcggaagttcgagct
gaaaggaggcgagatcttggccttgaagagtcatcaattgaactggcatcctcttctgta
aagagccacagcagctacctggacgtggggcagtgcggcagcagccaggaggccagccgg
gaaggagtgtcactgtcatcccacagctcccgccgctcctcgcacaccgcgctctccgac
tccgcctccacctcgtccatgcggcacaccgacaccagcactcccacccggacagcggtc
ccagagaaggcagccctgcggctggcgttggctggaggcgcccaggccatcgtaactcct
ccagcccccggcgaacacctccctcagcatcccgtggctcagccggcagtcccctctcag
cacgccgtgatgccagtgtaccacttcccggcccagctggggatgatgcaccagctgaaa
gagcagctggaggagaggactcgcatactgcaggcagacatcaagacacagcaagaggag
ctccacgtcatcaaggagcagctccagctggtgcaggactccaacctgcagatgctgatg
cagcagcctgttcccttggtcttcaacaacgtgcagcaccagagccccaggagacccccg
ccgcctcccaggacaccccggcagcccagcgccaagaagtccccccagccaggcccgatg
gggaccaagcactacgggggcccccacgtgtcctcaccgcgtcagttcctcagggagccc
tgtggcacatcctcacaggtaccgcagcagcagcacctcatgagaggaaaccaagcccag
caaacgtgtctgccagggcagacgagcatttcaatgcccctctacaacaaccccatggtg
ttttcgcaagcacatcccattacagtggctgcacagatgccgaccgacctgagtgaaagg
cagccgcagtccaactacagccaggacaggagcctcagaatgctgctggaccagtccatc
caagccatgatgcccgccgccaacggcagcgctcaggccacgctgagcggcaccagcagg
cagcagggaaaattcgtggcggagcagcagaccttgcctcccgccgtgcagatgcagccc
atcacctgcagcacagtccggccccccgccccctcgcccgtcttctccccgtccgtggtg
atcccccacgccagcttcacctcccaccagaccagtgccccagttcacctccaccagtgg
ccgcagcagcaggttcagcagcaccggctctaccttcagatgcaaagtcctgaggcggtg
ccggggggcccgagcccgcgtgttttccagccggcccacgtcgcgcagcagaaccccctg
agctacttcctgcacccgcagccacagagccgccacgcacagggccaggcctgcaacctg
caggacctgcccgaaatgcagctgccctga

DBGET integrated database retrieval system