KEGG   Anas platyrhynchos (mallard): 101801937Help
Entry
101801937         CDS       T02816                                 

Gene name
ACADS
Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial isoform X1
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00071  Fatty acid degradation
apla00280  Valine, leucine and isoleucine degradation
apla00410  beta-Alanine metabolism
apla00640  Propanoate metabolism
apla00650  Butanoate metabolism
apla01100  Metabolic pathways
apla01200  Carbon metabolism
apla01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101801937 (ACADS)
   00650 Butanoate metabolism
    101801937 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101801937 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101801937 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101801937 (ACADS)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     101801937 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 101801937
NCBI-ProteinID: XP_027325904
Ensembl: ENSAPLG00000016040
Position
16
AA seq 411 aa AA seqDB search
MAAALSRALPLALALSRGAPRARLHTVYQSAELPQTHLMLRQTCRDFAEKELMPLAAQLD
REHRFPAQQVKKMGELGLLAMDVPEEYKGAGLDYLAYSIAVEEISRGCASTGVIVSVNNS
LYLGPILKFGSEEQKHQWIAPFTSGEKIGCFALSEPGNGSDAGAATTVARLDGDEWVLNG
TKAWITNAWDASAAVVFATTDKALKHKGISAFLVPMPTPGLSLGKKEDKLGIRASSTANL
IFEDCRIPKANLLGQLGMGFKIAMQTLDAGRIGIASQALGIAQAALDCAVDYAEKRTAFG
SPITKLQAIQFKLADMAVALEGARLLTWRAAMLKDNGKPFTKEAAMAKLAASEAATSIAH
QAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGQLLKAYRG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgctgtcccgggccctgcccctggccctggcgctgtcccgcggcgccccc
cgggcgcggctgcacaccgtgtaccagagcgcggagctgccgcagacgcacctgatgctg
cgccagacctgccgcgacttcgccgagaaggagctgatgccgctggcggcccagctggac
agggagcaccgcttccccgcgcagcaggtgaagaagatgggggagttggggctgctggct
atggatgtgccagaggagtacaaaggcgcaggcctggactacctggcctattccatcgcg
gtggaggagatcagcaggggctgcgcgtccacgggcgtcatcgtcagcgtcaacaactct
ctgtatttagggccaattctcaagtttggttctgaggaacagaagcaccagtggattgct
cccttcaccagcggggagaaaatcggatgttttgctctcagtgagccaggaaatggcagc
gacgcgggagcggcaaccacagtggcacgcctggatggtgacgagtgggtcctgaacggc
accaaggcctggatcaccaacgcctgggacgcctcggctgctgtggtgtttgctactaca
gataaagccctgaagcacaagggcattagtgcgttcctcgttcccatgccaaccccgggg
ctgtcgctggggaagaaggaagacaagctgggcatccgcgcctcttccacggccaacctg
atcttcgaggactgtcggatacccaaggccaacctgctggggcagctgggaatgggcttc
aaaatcgccatgcaaactctggacgcaggccggatcggcatcgcctcccaggcgctggga
atagcgcaggcagccctggactgtgccgtggattatgctgagaagaggacggcgtttggg
tcgcccatcaccaagctgcaggccatccagtttaagctagcagatatggctgtggccttg
gagggggcgcgcttgctgacctggagagctgcaatgctgaaagacaacgggaagcccttc
acgaaggaagcggcaatggccaagctggcggcatcagaggctgcaacaagcatcgctcat
caggccatccagatcttgggtgggatgggttatgtgacagagatgccagcagaacgtcac
taccgtgatgctcgtatcactgagatctacgaggggaccagtgagatccaaaggctggtg
atagcaggtcaactgctgaaagcttaccgtggctga

DBGET integrated database retrieval system