KEGG   Anas platyrhynchos (mallard): 101802378Help
Entry
101802378         CDS       T02816                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00040  Pentose and glucuronate interconversions
apla00053  Ascorbate and aldarate metabolism
apla00140  Steroid hormone biosynthesis
apla00830  Retinol metabolism
apla00860  Porphyrin and chlorophyll metabolism
apla00980  Metabolism of xenobiotics by cytochrome P450
apla00982  Drug metabolism - cytochrome P450
apla00983  Drug metabolism - other enzymes
apla01100  Metabolic pathways
Module
apla_M00014  Glucuronate pathway (uronate pathway)
apla_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101802378
   00053 Ascorbate and aldarate metabolism
    101802378
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101802378
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101802378
   00860 Porphyrin and chlorophyll metabolism
    101802378
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101802378
   00982 Drug metabolism - cytochrome P450
    101802378
   00983 Drug metabolism - other enzymes
    101802378
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101802378
Glycosyltransferases [BR:apla01003]
 Others
  Hydrophobic molecule
   101802378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 101802378
NCBI-ProteinID: XP_012957854
Ensembl: ENSAPLG00000014719
Position
Un
AA seq 532 aa AA seqDB search
MAPVPASHLQVTVTLVLLLSVLGLAAGGKVLALPVGGSHWLSMREVLEGLKAKGHEVVVA
APEINLHIKPTDNFTMKMYPVPFTQEEMDKDFHAFLKGGFEEGSFLERFVRTYQRMKRLS
DFAFISCEHLLYNKELMRYLEESKFDVVFTDPVIPCGPIVAEHLSVPSVYFLRGIPCGLD
FEATQCPNPPSYVPRVFTEHTDHMSFLQRVKNLVFDVQNFFLCDFMYKPYSKLASEFLQR
DMTVLDLLRKASVWLLRLDFVLDYPRPLMPNIVLIGGVNCAHKELPQEFEAIVNASGEHG
IVVFSLGSMVSDIPMKKAREIADALGSVPQTVLWRYTGKVPSNLPQNVKLVKWLPQNDLL
AHPKTRAFITHGGSHGVYEGICNAVPMVLMPLFGDQMDNAKRVESRGAGLTLNILEMTSE
DMSNALKTVINDKKYKENIKRLSELHLDRPIHPLDLAVHWVEFVMRHKGAPHLRPAAHDL
NWIQYHSLDVIAFLLAVVLLSLFISFKCCMFCCRRCCFKKGRTRKPAKSKSH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccccagtgcctgcttctcacctgcaagtcacagtgacgctggttctgctcctgtcc
gtgctcggtctggctgctggtgggaaagtgctggcactgcctgtaggtgggagtcattgg
ctcagcatgcgggaagtgttggagggtctcaaggcgaaagggcatgaagtagtcgtcgct
gcacctgaaatcaatttacacataaaaccaacagacaattttactatgaaaatgtaccca
gtccctttcacacaggaagagatggataaggacttccacgcatttttaaagggtgggttt
gaagaaggatcctttctggaaagatttgttagaacataccaaaggatgaaaagactctct
gactttgcattcatcagctgtgaacacttactgtacaacaaagaacttatgagatacctt
gaggagtctaagtttgatgttgtctttacagaccctgtaataccttgcgggccgatagtg
gctgagcacctttcggtcccttctgtctattttctgcgaggaattccatgtggcttagat
tttgaagccactcagtgtcccaatcccccttcttatgtccccagggtgtttacagaacac
acagaccacatgagcttcctccagcgtgtgaagaatctggtctttgatgtccaaaatttt
ttcctctgtgattttatgtataagccgtactccaaactggcttctgagttccttcagcga
gatatgactgtgttagatctcttacgcaaggcttccgtatggcttctgagattagacttt
gtgttagattatccaagaccgttgatgcccaacatagttttaattggcggagtgaattgt
gctcacaaggagctacctcaggaattcgaagccatcgtcaatgcttctggagagcatggc
atcgttgtcttctcactgggctccatggtctctgacattcctatgaagaaagccagagaa
attgcagatgctttgggatcagtccctcagacggttttgtggcgatacacaggaaaggtg
ccctccaacctgccgcagaacgtaaagcttgtcaaatggctgccacagaatgatcttcta
gctcaccctaagactcgtgcctttattacccacggaggctcacatggtgtttatgagggc
atatgcaatgcagtgccaatggtactcatgcctttgtttggagaccagatggacaacgca
aagcgagtagagtcacggggagcaggactgacactgaatatacttgaaatgacttcagaa
gacatgtctaacgccttgaaaacagttattaatgataaaaagtacaaggagaacatcaag
cgtctctcagaacttcacctcgacaggcccatccaccccctggacctggccgtgcactgg
gtggagttcgtcatgaggcacaaaggggccccacacctgcgacctgctgctcatgaccta
aactggatccagtaccactccctggatgtcatcgccttcctcctggccgtggtgctcctc
tccctctttatttctttcaagtgctgcatgttctgctgccgcaggtgctgctttaagaag
ggaagaacacgcaagccagccaaatcaaagtcccactag

DBGET integrated database retrieval system