KEGG   Anas platyrhynchos (mallard): 101802385Help
Entry
101802385         CDS       T02816                                 

Gene name
MRPL22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla03010  Ribosome
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    101802385 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:apla03011]
    101802385 (MRPL22)
Ribosome [BR:apla03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    101802385 (MRPL22)
  Bacteria
    101802385 (MRPL22)
  Archaea
    101802385 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 101802385
NCBI-ProteinID: XP_027324303
Ensembl: ENSAPLG00000006714
Position
14
AA seq 223 aa AA seqDB search
MPAPRLQSAAGKMAAGRALGAGGSWLRGLLGWARPERWLASSSVFPLSCIHTSACLQKVG
KWEKKNRIVYPPQLPGEPRRPAEIYHCRRDIKYSKDKMWYLAKLIKGMSIDQALAQLEFN
DKKGAKVIKEVLLEAQEMAVKNHNVEFKSNLHIAESLTGRGQYTKRIRYHGKGMFGIMKL
VRCHYFVKLVEGPPPPPEPRKTGFDQAKEYVQQLRNRTLVHTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccccccgcctgcaaagcgcggccgggaagatggcggcgggcagggcgctgggc
gccggtggctcctggctgcgtgggctcctgggctgggcgcggccggagaggtggttagca
tccagtagtgttttccctctgtcatgcatccacacaagtgcatgtctacagaaagttggg
aagtgggagaaaaagaacaggatcgtttaccctccgcagctgcctggagaacctcgcaga
ccagctgaaatatatcactgtcggagggacataaaatacagcaaagataagatgtggtat
ctggcaaaactgataaaaggaatgtccattgatcaggctcttgctcagttggagtttaat
gataaaaagggagcaaaggtgatcaaagaggttctgttagaagctcaagaaatggcagta
aaaaatcacaatgtggaattcaaatcaaatttacatatagctgagtcattaacaggcaga
ggccaatatacgaaacggattcgttaccatggtaaaggcatgtttggcatcatgaaacta
gtcaggtgccactactttgtgaaactggtggaaggtcctcctcctcctccagagccacga
aagactggttttgatcaagcaaaagaatatgtgcaacagctgcgaaatagaacacttgtt
catacactgtga

DBGET integrated database retrieval system