KEGG   Anas platyrhynchos (mallard): 101802542Help
Entry
101802542         CDS       T02816                                 

Gene name
KCNK2
Definition
(RefSeq) potassium channel subfamily K member 2 isoform X1
  KO
K04913  potassium channel subfamily K member 2
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:apla04040]
    101802542 (KCNK2)
Ion channels [BR:apla04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   101802542 (KCNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 101802542
NCBI-ProteinID: XP_021124680
Ensembl: ENSAPLG00000009845
Position
3
AA seq 437 aa AA seqDB search
MTAFGRFTETDSGVKFLRPTPTWYVAAPDLLDPKSATQNSKPRLSFSTKPTVLTSREESD
SAINVMKWKTVSTIFLVVVVYLIIGATVFKALEQPHETSQKTTIVIQKQTFVSQHSCVNA
TELDELIQQVVAAINAGIIPLGNTSTQISHWDLGSSFFFAGTVITTIGFGNISPRTQGGK
IFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFVKWNVSQTKIRIISTIIFIL
FGCVLFVALPAVIFKHIEGWSTLDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWF
WILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEI
YDKFQRATSIKRKLSAELAVNHNQDLTPCKRTLSVNHLTSEKDILPALTKTDSIYMNGLT
PHCAAEEIAVIENIKQL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctttggccgttttacagagacagactctggcgtgaaattcttgcgacctaca
cccacttggtatgtggcggcacctgacttgctggatcccaaatcggccactcagaactcc
aaaccaagattatcattttctaccaagcctaccgtgctcacttcacgggaggaaagcgat
tcagctattaatgttatgaaatggaagacagtctcaacaatttttctggtggtggtcgtg
tatttaataattggagcgacagtgtttaaagccctggagcaacctcatgaaacctcccag
aaaaccaccattgtgattcagaagcagacgtttgtgtctcagcattcctgtgtgaatgca
acagagcttgatgaactgattcagcaagtagtggcagcaataaatgcaggaatcatacct
ttaggaaacacatctactcagatcagtcactgggacttgggaagttccttcttctttgct
ggcactgttattaccaccataggctttggaaacatctccccacgcacacaaggtggaaag
atattctgtatcatctatgccttactgggaattcctctctttggttttctcttggctggt
gttggagatcaactagggacaatctttggaaaaggaattgccaaagtagaagataccttc
gttaaatggaatgtgagtcagacaaagattcgcataatttcaacaataatattcatactg
tttggctgcgtgctgtttgttgctcttcctgcagttatattcaagcatatagaaggctgg
agcacactagatgcaatttactttgtggttatcactttaactaccattggatttggtgac
tatgttgcagggggatcagatattgagtacctagatttttataagccagtggtgtggttc
tggatccttgttgggcttgcttactttgcagctgtcctcagcatgatcggagactggcta
agagtcatatcaaaaaagacaaaggaagaggtaggggaattcagagcccatgctgcggag
tggacggccaatgtcaccgcagagttcaaagaaacgcgaaggcgtctcagtgtggagatc
tacgacaagttccagcgggctacctccatcaaaagaaagctctccgctgaacttgctgtc
aaccacaatcaagatctgactccttgcaagagaaccctgtcagtcaaccatctcaccagt
gagaaggacatcttgccagctcttacaaagacggacagcatttatatgaatggtttgaca
ccgcactgtgcagcagaagagatagccgttattgaaaatattaagcagctgtga

DBGET integrated database retrieval system