KEGG   Anas platyrhynchos (mallard): 101803235Help
Entry
101803235         CDS       T02816                                 

Gene name
MTMR1
Definition
(RefSeq) myotubularin-related protein 1 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00562  Inositol phosphate metabolism
apla01100  Metabolic pathways
apla04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101803235 (MTMR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101803235 (MTMR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:apla01009]
    101803235 (MTMR1)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101803235 (MTMR1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101803235 (MTMR1)
Protein phosphatases and associated proteins [BR:apla01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101803235 (MTMR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase 3-PAP Y_phosphatase3 DUF4441
Motif
Other DBs
NCBI-GeneID: 101803235
NCBI-ProteinID: XP_027320875
Ensembl: ENSAPLG00000000577
Position
10
AA seq 688 aa AA seqDB search
MERAAAAGPPGEGGGVVRGRAGRPGVAAAAGAAGTGSRQASTETLDSPTGSHVEWCKQLI
AATISSQISGSVPPEGVSRDYRVFRRPDIREIQDGHNGYHSEGEADQALRDGNKLAQMEE
APLFPGESIKVIAKDVMYICPFMGAVSGTLTVTDFRMYIKSVERDPPFVVDVPLGVISRV
EKIGVQSHGDNSCGIEIVCKDMRNLRLAYKQEEQNRLEIFENLVTRAFPVSNGLPLFAFN
YKEKFAVNGWKVYDPMAEYKRQGLPNESWKISKVNNTYELCDTYPAVLVVPTSVKDDDLS
KVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKHCKEDEKYLQTIMDANAQSHKL
IIFDARQNSVADTNKAKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPTIDE
TRWLSNVDSTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTALAMLMLD
SYYRTIKGFEILIEKEWISFGHRFAMRVGHGGDDHADADRSPIFLQFIDCVWQMTKQFPA
AFEFNELFLITILDHLYSCLFGTFLCNCEKERLKEELSTKTVSLWSYINSQLDEFTNPFY
VNYENHVLYPVASLNHLELWVNYYVRWNPRMRPQVPIHQNLKELLAIRSELQKKVEDLQR
EAATRSISSSSDRGSSPSHSATPVHTSV
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggcggcggcggccgggccgccgggggagggcggcggcgtggtgaggggccgc
gccgggcggccgggggtggcggcggcagcaggagcagcggggaccgggtcgcggcaggcc
agcaccgagacgctggacagccctactggatcacatgttgaatggtgcaaacagctgata
gctgcaacaatttctagtcagatttctgggtcagtccctccagaaggcgtgtccagagac
tacagggtgttcaggaggcctgacatacgggagattcaggatggacacaatggctatcat
tctgaaggagaagctgatcaggcactacgggatggaaacaaactagcacagatggaagag
gctccgctttttcctggagaatccatcaaagttattgctaaagatgttatgtacatctgt
ccatttatgggagcagtcagtggtacactgacagtgacggacttcagaatgtacatcaaa
agtgttgaaagggatccaccttttgttgttgatgttcctcttggagtgataagtagagtt
gaaaaaattggagtacagagccatggagacaactcatgtggtatagaaatagtttgcaag
gatatgagaaatttgcggcttgcctataaacaggaagagcagaacagattggagattttt
gaaaaccttgtaacacgtgcatttcccgtgtctaatggactgcctctttttgcattcaac
tacaaagaaaagtttgctgttaatggatggaaagtatacgatccaatggcagaatataag
aggcagggcttgcctaatgagagttggaaaatatccaaagttaacaacacctatgagctt
tgtgatacatatcctgctgttcttgttgtgccaaccagtgtaaaggatgatgacctctca
aaagtggcagcgtttagagccaaaggcagagttccagtgttatcctggattcatcctgag
agccaagcaacaataacacggtgcagtcaaccattggttggcccaaatgataagcattgt
aaagaagatgaaaaatacttacagacaataatggatgccaatgctcagtcacataaactt
atcatctttgatgccaggcagaatagtgttgcagatacaaacaaggcaaaaggtggagga
tatgaaagtgaaagtgcctacccaaatgcagagctggtctttctcgaaattcacaatata
catgtaatgagagaatccttgcgtaaacttaaagaaatagtttatcctactatcgatgag
actcggtggttatcaaatgtggactcaacgcattggctggaatatataaggatgcttctt
gctggagcagtaagaattgcagataaaattgagtctggtaaaacatcagtggtggtacat
tgcagcgatggttgggatcgaactgcacaacttactgcgctagctatgctaatgctggac
agctattacagaactatcaaggggtttgaaatccttatagagaaagaatggataagtttt
ggacaccgatttgcaatgagagtaggacatggaggtgatgatcatgctgatgcagacaga
tctcccattttccttcagttcattgactgtgtttggcaaatgacaaagcagtttcctgca
gcctttgaattcaatgagttatttttgatcaccattctggatcatctttatagttgtctc
ttcgggactttcttatgcaactgtgaaaaagagagattaaaagaggagctaagcacaaag
actgtatcgttgtggtcctatataaacagtcagttagatgaattcacaaatcctttctac
gtaaactatgagaaccacgtcctgtatcctgttgccagtctgaaccatttggaactgtgg
gtcaactactatgtcagatggaacccaagaatgaggcctcaggttccaatccatcagaat
ctcaaagagctccttgccatccggtctgagctccagaagaaggttgaagatctgcagcgg
gaagctgccacgcggtccatttcttcctcctccgatagaggttcatctccttcccactca
gcaacaccggtacacacttctgtgtga

DBGET integrated database retrieval system