KEGG   Anas platyrhynchos (mallard): 101803635
Entry
101803635         CDS       T02816                                 

Gene name
NPAS3
Definition
(RefSeq) neuronal PAS domain-containing protein 3 isoform X3
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101803635 (NPAS3)
Transcription factors [BR:apla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101803635 (NPAS3)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_9 HLH
Other DBs
NCBI-GeneID: 101803635
NCBI-ProteinID: XP_012957931
Ensembl: ENSAPLG00000015085
Position
5
AA seq 910 aa
MLVFSGEEGEYVKQLELMRITVQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRD
AARSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRM
EGPPPNTSVKVIGAQRRRSPSALAIEVFESHLGSHILQSLDGFVFALNQEGKFLYISETV
SIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQ
SETPEPVESTSPSLLTSDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSL
SHGRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTP
VDIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAVNA
KNASEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDNSEDNENS
KSDEKGNQSENSEDPESDRKKSGNQSDNEMNCNDDGNSSSNQDSRDSDDSFENSDFENQK
APEDSFGTLGSMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEVNAQSSSKHQKRK
KRRKKQKGGSMTRRRLSSTSSPNGLDSALVDQPQLLSSPNSASVLKIKTEISEPINFDND
SSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQASSSLHVSIPDSVLTPPGTENTASRK
TQFSTSSNSALAPVSSDPLSPPLSASPRDKHPGGPTTSNSLLYTGDLEALQRLQAGNVVL
PLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNTHAVNFVDVNSPSFGL
DPKTPMEMLYHHVHRLNMSGPFGSAVSGASLTQMPAGNVFTTAEGLFSTLPFPVYSNGIH
TTQTLERKED
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgctggtatttagtggggaggaaggggagtatgtgaaacagctggaactcatgagaata
actgtccagcatcctctgcccaaccaatcagaatgtaggaaaatctacagatatgacgga
atctactgtgaatctacctaccagaatttacaagctttgaggaaggaaaagtcccgagat
gctgctcgatctcgccggggaaaggagaattttgaattctatgagttggcaaagttgttg
ccgctgcctgcagccattaccagccagcttgacaaggcatccatcatccgacttacaatt
agctatctgaaaatgagggactttgctaatcaaggcgatcctccatggaacttgagaatg
gaaggacctccacctaatacatcagtaaaagttataggtgcccagcgcaggagaagtccc
agtgcccttgccattgaagtatttgagtcacatttgggaagtcatattttacagtcactg
gatggatttgtatttgcactaaatcaagaaggaaaatttttgtacatttcagaaactgtc
tccatctatttaggcctgtcccaagtggaactgacaggcagcagtgtgtttgactacgtc
cacccaggagaccatgtggagatggcagagcagctgggcatgaagcttcccccggggcga
ggccttctctcacagggtacagccgaggatggagccagctcagcatcctcatcttcccag
tccgagacccctgagccagtggaatctacaagccccagtttactaaccagtgacaacact
ctagagcgctcttttttcatccgaatgaaatctacactgaccaagcgaggagtgcacatc
aaatcgtcaggatacaaggtgattcatataacaggccgcttacgtctgagagtgtcactg
tctcatggacggacagtacccagccaaatcatgggacttgttgtcgttgctcatgcttta
ccacctcctacaattaatgaagtcaggattgactgccacatgtttgtcactcgtgtgaat
atggacctcaatatcatttactgtgaaaataggattagtgattacatggatctgacccct
gtagatattgtaggaaagagatgctatcacttcattcatgctgaagatgtggaaggcatc
aggcatagtcacttagacttgctgaataagggtcagtgtgtaacaaagtattaccgctgg
atgcagaagaatggaggttatatctggatacagtctagtgcaactatagctgtcaatgcc
aagaacgcaagtgagaagaatatcatctgggtcaactaccttctcagtaacccagaatac
aaggatactcctatggatattgcacaacttcctcatctgccagagaaaacctcagaatcc
tcagagacctctgactctgaatcggactcaaaggacaactcagaggacaatgagaactca
aagtcagatgagaaaggaaaccagtcagaaaacagtgaagaccctgaatccgacaggaaa
aagtcaggaaatcagtcggataatgaaatgaactgcaacgatgatgggaacagctccagc
aaccaggacagcagggacagtgatgacagctttgaaaactctgactttgagaatcaaaag
gcccctgaggacagttttggcactcttggctctatgcagatcaaggtggagcgttatgtt
gagagtgagtcagacctgcggttgcagaactgtgaatcactgacctcggacagtgccaag
gactcagacagtgcaggagaagtaaatgcccagtcttccagcaaacatcaaaaaaggaag
aagaggagaaaaaagcaaaagggaggcagcatgacccggagaaggctgtcaagcacctca
agcccaaatggacttgactcagctttggtggaccagccccagctgctctcgtcgccaaac
agtgcctcagtgctcaaaattaaaacagaaatctcagaacctatcaattttgataatgat
agcagtatttggaattacccacccaacagggaaatctcaaggaatgaatcaccctacagt
atgaccaagccccccagctccgagcacttcccttcccctcaagccagcagtagtttacat
gtctccattccagactctgttctcaccccaccagggactgaaaatactgccagccgtaaa
actcagttcagcacctcatccaactcagccttggctcctgtgtcctctgaccctttgtca
cccccgctttcagcatctccacgggacaaacatccaggaggtcccacaacttccaactct
ttgttgtacactggggatctggaagcccttcagaggttacaagcaggcaatgtggtgctt
cctttggttcacagggtaacaggaacccttgccgcgaccagcactgctgctcagagggtc
tacaccactggcactatccggtatgctccagctgaagttactttagccatgcagggcaac
ctcctccccaacacccatgctgttaactttgttgatgttaacagccccagctttgggctg
gatcctaaaacaccgatggaaatgctctaccaccacgttcaccgactcaatatgtcggga
ccatttggaagtgctgtgagcggggccagtctgacccaaatgcctgcagggaatgtgttc
acgactgccgaaggacttttttccactcttccatttcctgtgtacagcaatggcattcat
actacacagactctggaacggaaagaggattga

DBGET integrated database retrieval system