KEGG   Anas platyrhynchos (mallard): 101803794Help
Entry
101803794         CDS       T02816                                 

Gene name
CACNA1I
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101803794 (CACNA1I)
   04020 Calcium signaling pathway
    101803794 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:apla04040]
    101803794 (CACNA1I)
Ion channels [BR:apla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101803794 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 101803794
NCBI-ProteinID: XP_027306763
Ensembl: ENSAPLG00000009947
Position
1
AA seq 2093 aa AA seqDB search
MMVILLNCVTLGMYQPCEDMDCLSDRCKILQVFDDFIFIFFAMEMILKMVALGIFGKKCY
LGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDT
LPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFMEENFTIQGDIVLPPYYQPEEDDEM
PFICSLSGDNGIMGCHEIPPLKERGHECCLDKDDYYYYNSVRQEFNISGMCVNWNQYYNV
CRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVG
SFFMINLCLVVIATQFSETKQREHQLMQEQRARYLSSSTVASYMEPGDCYEEIFQYVCHI
VRKAKRRTLGLYNSIQSRRQGHAEPSNAKLGMHRKSQRHYRLCQQHNSLDCPPQGLVQPI
AVTATSDPTNCPRCHRGEHDASRRLSVLGSADSDQEDGGASEEEGEGSRGDQGASAPEKE
EEEVEEGGRLKLCSDMWREVRVKLRGIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELT
NILEISNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIIGQSDGGLSV
LRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFS
LRTDTGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFG
NYVLFNLLVAILVEGFQAEGDANRSYSEEDQSSSNIEELDQFQEVQEGSDPKLCAIPVTP
NGHLDPSLPSSNPPVAAGGVTNSSRNSLQPDQIRVAVGSRKSSVMSLGRMTYDQRSLSSS
RSSHYGAWGRSGAWGSRRSSWNSLARGHSLKHKPPSAEHESLLSGERHRAGDKEPDGAGR
VFHHRRTLSLDNKGSCDLLELASVPSTHRGTRKLGTVPGASEHQDCNGKMPSIAKEIFPK
MNNRKERGEDDEEIDYSLCFRIRKMMEVYKPDWCELREDWSIYLFSPQNRFRLLCQTIIA
HKLFDYVVLAFIFLNCITIALERPQIEHRSTERIFLTVSNYIFTAIFVAEMTLKVVSLGL
YFGDQAYLRSSWNILDGFLVFVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISR
APGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDIRNITNRSD
CVAANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNNNPWML
LYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLP
YYATYCPIRLLIHSVCTSHYLDIFITFIICLNVVTMSLEHYNQPVSLETALKYCNYLFTT
VFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMR
VLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCND
ENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCSHDDRSCLSNLQFISPL
YFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEFSHGLCSRKSGSPNS
GQGKGAGAGTGGSGGRTDPEGRLCMRCYSPAQENLWLDSVSLIIKDSFDGELMIIDNLSG
SVFHHYSSPAMCEKCNHDKQEVQLAEMEALSLNSDKSSSILLGDESDNRSTSQLSPKETK
DGKDSPDSTGVGDLGECLLPISSADGSTNPDSYLCEMEKTPFNTVQSWLKHEGTKVPPSP
YSPGTSCPLLPVPAEFFHPAISATQTGPEKVSCPRNLPKISLQGSWASLRSPSVNCSLLH
QAPESDTSLDSRSSSSAGSLQTTLEDSLNLSDSPQCTWTSRWPCAPYQLPATKPLAAPLS
PASRRRSLRGRGLFSLRSIRRHQRSHSSGGSTSPGCTHHDSMDPSDEEGAGSSLRGGGNN
SEPSETLSSLSLTSLFSPPPPGLTLGKKCSSTSSLHASPSPRRPAAHHAKPFYTVDPRGF
LSMPSWVTDFCKDTPSPGQGEEPDGPGRLGTGERGSPLPSELELGDGVSKRNR
NT seq 6282 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgattttgctaaactgcgttaccctggggatgtaccagccatgtgaggatatg
gactgcctgtctgacaggtgtaaaatcttgcaggtatttgatgatttcatcttcatcttc
tttgcaatggaaatgattttaaagatggtggccctggggatctttggcaagaagtgttac
cttggggatacctggaaccgcctggacttctttattgttatggctgggatggtggagtac
tccctggatctccaaaacattaacttgtctgcaatccgtactgtccgcgtcctgagaccc
ctgaaagctatcaaccgtgtgcccagcatgcgcatccttgtgaatttgctcctggacacc
ttgcccatgctggggaacgtcctcctcctctgcttctttgtcttcttcatcttcggcatc
atcggggtgcagctgtgggctgggctgctccgcaaccgctgcttcatggaggagaacttc
acaatacaaggtgacattgtcctgccaccttattaccagcctgaggaagatgatgagatg
ccctttatctgctcgctgtcaggagacaatggaatcatgggctgtcacgagatcccgccc
ctgaaggagcggggccatgagtgttgtttggacaaggacgattattattactacaactca
gtccggcaagagttcaacatcagtggcatgtgtgtcaactggaaccagtactacaacgtg
tgccgtacaggaaacgccaacccgcacaagggtgccatcaactttgacaatattgggtat
gcctggattgtgatatttcaggtgatcacactggaagggtgggtggagatcatgtactat
gtgatggatgcccattcattctacaattttatctactttatcttgctgataatcgtgggc
tccttcttcatgattaacctgtgcctggtggtcatcgccacgcagttctcggagaccaag
cagcgggagcaccagctgatgcaggagcagcgggcccggtacctctcctccagcaccgtc
gccagctacatggagccgggagactgctacgaggagatcttccaatacgtctgccacatc
gtgcgcaaagccaagcgccgcacccttgggctgtacaacagcatacaaagccggcgccag
ggccacgcggagccgagcaatgccaagctaggcatgcacaggaaaagccagaggcactac
aggctttgccaacagcacaactctcttgactgccctcctcagggcttggtccagcccatt
gctgtgacagcaacctctgatcccaccaactgtccccgatgccacaggggggaacatgac
gcatcccgaagactctctgtcctgggcagcgctgattcagaccaggaggacggaggagcc
agtgaagaggagggagagggcagcagaggggaccagggtgcctcagcaccggagaaggag
gaggaggaggtggaagaaggcggacggctgaagctctgcagtgacatgtggcgggaagtg
agggtcaagcttcgagggattgtggacagcaagtacttcaaccgtgggatcatgatcgcg
atccttgtgaacaccatcagcatgggcattgagcaccacgagcagccagaggaattgacc
aacatcttggagataagcaacgttgtctttacaagcatgtttgccctagagatgatcctg
aaacttgctgcttttggtctctttgattaccttcgcaacccctacaacatctttgacagc
atcatcgtcatcatcagcatctgggagatcatcggccagtcggacgggggcctctctgtg
ctgaggactttccgtctcctgcgggtgctgaagctggtgcgtttcatgcccgcactgcgc
cgccagctcgtggtgctgatgaagactatggacaacgtggccaccttctgcatgctcctt
atgctcttcatcttcatcttcagcatcctcggaatgcacatctttggttgcaagtttagc
ctcaggacggacacaggagatacaattcccgaccggaagaattttgactccctgctgtgg
gccatcgtcaccgtcttccagatcctaacccaagaggactggaatgttgtgctctataat
ggcatggcctccacctcaccatgggcatccctttactttgtggctctcatgacatttggc
aattatgtgctcttcaatctgctggtggccatccttgtggagggattccaggctgagggc
gatgccaaccggtcatactcagaggaagatcagagttcatcaaacatagaggagttagat
cagttccaagaggtccaggaaggctcagatcccaagctctgtgccattcctgtgacacca
aatggacacttggacccatccttgccctcctccaacccaccagtggctgctgggggagtc
accaactcctcacgtaactccctgcagcctgaccagatccgtgttgctgttggctcccgg
aagagcagcgtgatgtccctggggagaatgacctatgaccagcggtccttgtccagctct
cgcagttcccactacggggcctggggccgcagcggggcctgggggagccgtcgctccagc
tggaacagcctggcccgaggacacagcctgaagcacaaacctccctctgccgagcacgag
tccctcctgtccggggagaggcacagggcaggagataaggagccagatggggcagggagg
gtgtttcatcaccgccggacactctccctggacaacaaaggctcctgcgacctgctggag
ttggcctctgtcccatccacccacagagggacccgtaagctcgggacggtgccaggggcc
agcgagcatcaagactgcaatggcaaaatgcccagtattgccaaggagatcttcccaaag
atgaacaaccgcaaggagcgtggggaggatgatgaagagatcgattatagcctgtgcttt
cgcatccggaagatgatggaagtctataagccagactggtgtgagctccgggaagactgg
tccatatatctcttttctcctcaaaacaggtttcgcctcctctgccaaaccatcattgct
cacaagctctttgactatgttgtgctggccttcatcttcctgaactgcatcaccattgcc
ctggagagaccgcagattgaacacagaagcacggagagaatctttcttactgtgtccaac
tacattttcacagcaattttcgtagctgagatgacgctgaaggtggtttctctaggcctg
tattttggtgatcaggcttatctccgcagcagctggaacatcctggatggcttcttggtc
tttgtgtccctcatcgacattgtggtctcggtagcttctgctggtggtgccaaaatcctg
ggggtgctgcgggtcctccggctgctgcgcaccttacggcccctccgagtcatcagccga
gcccctggcctgaagctggtggtggagacgctcatttcttccctcaagcccataggaaac
attgtcctcatctgctgtgctttcttcatcatcttcgggatcctgggtgtgcagctcttc
aaaggcaagttctaccactgcctgggggtcgacatcaggaacatcaccaaccgatccgac
tgcgtggctgccaactacaagtgggtgcaccacaagtacaactttgataacctgggacag
gccctgatgtctctctttgttctggcttccaaggatggctgggtcaatattatgtataat
ggactagatgctgtggctgtagaccagcagccggtcaccaacaacaacccctggatgctc
ctctacttcatctctttcctcctcatcgtcagcttctttgtgctcaacatgtttgtgggg
gtggtggtggagaacttccacaagtgccggcagcaccaggaggccgaggaggcacgccgg
cgggaggagaagcgcctgcggcgcctggagaagaagagaaggaaagcgcagcgtttgccg
tactatgctacctactgccccatacgcctccttatccattcggtctgcaccagccactat
ctggacatcttcatcactttcatcatctgcctcaacgtggtcaccatgtccttggagcac
tacaaccaacctgtgtccctggagacagctcttaagtactgcaactacctgttcaccact
gtctttgtgttggaggcagttctcaagctggtggcatttggtctgcggcgattcttcaaa
gacaggtggaaccagctagatctggccattgtgttgctgtctgtcatgggcatcacactg
gaagagattgaaatcaatgctgctctcccaattaaccccactatcatccggatcatgagg
gtgctgcgcattgcccgggtcctgaagctactgaagatggccacaggaatgcgagcactc
ctggatacagttgttcaagccctgccacaggtggggaaccttggactgcttttcatgctg
ctctttttcatctacgctgctctaggagtggagctctttggaaaactagtgtgcaatgac
gagaacccctgtgagggcatgagccgtcacgccacctttgagaacttcgggatggctttc
ctcacgctgttccaggtgtccacaggtgacaattggaacgggatcatgaaggatacctta
cgtgactgcagccacgatgaccggagctgcctcagcaacctgcagttcatctccccactg
tactttgtcagctttgtgctcacagcccagtttgtcctcatcaatgtggtggtagctgtg
ctcatgaaacatctggatgacagcaacaaggaagcccaggaggatgcggagatggatgct
gagattgagctggaattttcgcatgggctgtgctcccgcaagtcaggttctccgaattca
gggcagggaaaaggagcaggagcaggaacaggaggcagtggtgggagaacagatcctgaa
ggacggctgtgcatgagatgctactctccggcacaggagaacttatggctggacagtgtc
tctttaattattaaggactccttcgacggggagttaatgatcatcgataacctatcgggc
tccgtcttccatcattactcctcgccggccatgtgcgagaagtgtaaccatgacaagcaa
gaggtccagctggctgaaatggaagcattatctctcaactcagacaagtcctcttccatc
cttctaggagatgagtcagataatcgcagcacgtctcagctgagtcccaaggagaccaag
gatggcaaggacagccctgactccactggggtaggagatttaggggaatgcctcctcccg
atatccagtgcggatggctctacaaatccagacagttacttgtgtgaaatggagaaaact
cctttcaacacagtccagtcttggctaaagcatgaaggtaccaaagtccctcccagcccc
tattctccaggtacatcttgccctctgttacctgtaccagcagaatttttccacccagcc
atctctgccacccagacagggcctgagaaggtctcgtgtccacgcaaccttcctaagatc
tctctgcaaggctcatgggcatcactgagatctccaagtgtgaactgttcacttcttcac
caggcccccgagagcgacacctcgctggacagccggagcagcagctcggcgggcagcctg
cagaccacactggaggacagcctcaacctcagcgactctccccagtgcacctggacctcc
cggtggccctgtgccccgtaccagctgccggcgaccaaacccctggcggcccccctctcc
ccggcctcccgtcgccgcagcttgcggggccgggggctcttcagcctgcggagcatccgc
cggcaccagcggagccacagcagtggcgggagcaccagccccggctgcacccaccacgac
tccatggacccctcggatgaggagggggcaggcagcagcctgcgggggggcggcaacaac
agcgagccctcggagaccctcagcagcctctcgctgacctccctcttctcacccccgccg
ccggggcttacgctggggaagaagtgcagcagcaccagcagcctccacgccagcccctcg
ccccgccgccccgccgcacaccacgccaagcccttctacactgtcgacccccggggcttc
ctctccatgccctcgtgggtgacggacttctgcaaggacaccccctcgcccgggcaagga
gaggagccagacggccctggcagactggggacaggggagcgtggctccccgctgccgtcc
gagctggagctgggtgacggggtcagcaagaggaacagatga

DBGET integrated database retrieval system