KEGG   Anas platyrhynchos (mallard): 101804195Help
Entry
101804195         CDS       T02816                                 

Gene name
H6PD
Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00030  Pentose phosphate pathway
apla01100  Metabolic pathways
apla01200  Carbon metabolism
Module
apla_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
apla_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101804195 (H6PD)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     101804195 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     101804195 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N DUF5617
Motif
Other DBs
NCBI-GeneID: 101804195
NCBI-ProteinID: XP_005015486
Ensembl: ENSAPLG00000009884
Position
22
AA seq 790 aa AA seqDB search
MLRRVLCTMFFMGALPSPAEMSQGHISVVLLGATGDLAKKYLWQGLFQLYMDQVSSGHSF
TFHGAALTALEPGQKMMFDVLKKLACPPDEAPDRCAVLKDQFLKLSQYHQLKTAENYTVL
NREIEVLLRQEGLKEAGRIFYFSVPPFAYTEIARHINSSCRPPPGAWLRVVLEKPFGHDL
ESAQQLAAELTSFFREEEMYRVDHYLGKQAVAHILPFRDQNQEFLDPIWNRHHVERVEIV
LKEVVDAKGRTSFYEQYGVIRDVLQNHLTEALMFLTMELPGNLSRTEEVLQCKLQALRSL
RGLEKHSAVLGQYQAYASHVQEELKKGQDYVSTTPTFAGVLVQSDSLRWEGVPFLLTSGK
ALDERVGYVRVLFKNRAYCTQSETLRDAGHSQCKAKQIIFYIGHGALNTPAVLVSRNLFR
PVMPKSSWREVVGQPELHVFGQPLSDYYVYSPVKERDAYSVLISNIYHGRKDFFITTENL
LASWAFWTPLLNSISQQPPRLYPGGVENQNLLDFEMVSGELAFTAAEPVELLHPDRSMPS
DFKTIQSKFRQSPLVSMWSEDLISQLASDVEKAANRAVAGSGQFHLALSGGSSPVALFQR
LARHHYAFPWRHTHIWLVDERCVPLTDPESNFFSLHSHLLQSIRVPYFNVHPMPVHLNQR
LCVEEDGGTELYAKEIAALVANSSFDLVLLGLGTDGHTASLFPDSEDGLEGTQAVVLTES
PIKPHQRMSFSLSLINKARQVFVLVVGKGKHDITTQISRVGRQPRKWPISGVSPSSGQLV
WYVDYEALLG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaagagtgctgtgtaccatgtttttcatgggagccttgccatcgccggctgag
atgtcccagggccacatctccgtggtcttgctgggagccacaggtgatttggccaagaag
tatttgtggcagggcctcttccagctctacatggaccaagtgagcagtggccacagcttc
actttccacggggctgcgctgacagctctggaaccagggcagaagatgatgtttgatgtg
ctgaagaagctggcctgtcccccggatgaggctccggacagatgtgctgtgctgaaggac
caattcttgaagctgagccagtaccaccagctgaagaccgccgagaactacactgtgctc
aacagggagatcgaggtgctgcttcgccaggagggcctgaaggaggctggaagaatcttc
tacttctcagtacctccgtttgcctacacggagatcgcccggcacatcaacagcagctgc
agaccccctccgggcgcctggctgcgtgtggtgctggagaaaccttttggccacgacctg
gagtcggcccagcagctggctgcagagctgacgagcttcttcagggaagaggagatgtac
agggtggaccactacttgggcaagcaggctgtagcccatatcctgccttttcgagaccag
aaccaggagtttctggatcccatctggaaccgacatcatgtggaaagagtggagattgtc
ctgaaggaggttgtggatgccaaaggccgcaccagcttctacgagcagtacggagtcatc
cgggatgtgctgcagaaccacctcaccgaggccctgatgttcctgaccatggagctcccg
ggcaacctgagtaggaccgaagaagtcttgcagtgcaagctgcaggccctccggtccttg
cggggcctggagaagcacagtgctgtgttgggtcagtatcaggcgtacgccagccacgtg
caggaggaactgaagaagggacaggactatgtcagcacgacaccaaccttcgcaggtgtg
ctcgttcagagtgacagcctgcgttgggaaggggtccctttcctcctcacttctgggaaa
gccctggatgaacgggtaggttacgtccgtgttctcttcaagaaccgggcctactgcacg
cagagtgagacgctgcgggacgcagggcacagccagtgtaaagccaagcagatcatcttc
tacatcggacatggcgcactcaacacccctgcagtgcttgtgagcaggaaccttttcagg
cctgtcatgccaaaaagcagttggagagaagttgtaggtcagccagagctgcatgttttt
ggacaaccgctgtctgattactacgtgtacagccctgtgaaggagagagatgcgtattct
gtccttatttccaacatataccacggcaggaaggacttcttcatcaccactgagaacttg
ctggcctcctgggccttctggacaccgctgctgaacagcatttctcaacagcccccgcgc
ctctaccctggtggggtggagaaccaaaacctcttggactttgaaatggtgagcggggag
ctggcgttcacggcggcagagccggtggaactgctgcaccccgacaggtcgatgccaagt
gatttcaagacaatccagtccaaatttcggcaaagccccttggtgtcaatgtggtccgag
gacctgatttcccagctggcttctgatgttgagaaggcagcaaacagggctgtggcaggc
tctgggcagttccacctggctttgtccggcggctcaagccccgtggccctattccagcgg
ctggcaaggcaccattatgccttcccgtggaggcacacccacatctggctggtggatgag
cgctgcgtccccctcactgacccggagtccaacttcttcagcctgcacagccacctcctg
cagagcatcagggtgccctacttcaacgtccaccccatgcctgtgcacctgaaccagcgg
ctctgcgtggaagaggatggaggcacggagctttatgccaaggagatcgcagccctggtg
gccaattccagctttgacctggtgctgctggggctgggcactgacgggcacaccgcctcg
ctcttccccgactctgaagacggcctggaagggactcaggctgtggtgctgaccgaaagc
cccatcaaacctcaccaaaggatgagcttcagcctgtccctcatcaacaaagccaggcag
gtgttcgtgctggttgtggggaagggcaagcacgatatcaccacccagatcagcagggtg
ggccggcagccaaggaagtggcctatctcgggtgtcagccccagctctggccagctggtg
tggtatgtggattatgaagctctgcttgggtga

DBGET integrated database retrieval system