KEGG   Anas platyrhynchos (mallard): 101804219Help
Entry
101804219         CDS       T02816                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101804219 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:apla04040]
    101804219 (GRIA1)
Ion channels [BR:apla04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101804219 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 101804219
NCBI-ProteinID: XP_027324082
Ensembl: ENSAPLG00000008617
Position
14
AA seq 902 aa AA seqDB search
MQHIFAFFCTSFLGAVLGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVETSNQ
FVLQLRPELQDALISVIEHYSWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQELEKKKERLVVVDCESERLNIILSKIIKLEKNGNGYHYILANLGFMDIDL
TKFKESGANVTGFQLVNYTDAVPARIMQQWRNNDAREHPRVDWKRPKYTSALTYDGVRVM
AEAFQNLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLSGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDEKLVPAAIDTQTGNESTSLQNRTYIVTTILEDPYV
MLKKNANQFEGNERYEGYCVELAAEIAKHVGYHYRLEIVRDGKYGARDPDTKTWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEEGRDQPANDQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRPAAAGGSGENGRVVSHDFPKSMQTIPCMSHSTGMSLGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccagtttcctaggggcagtgttaggggccaat
ttccccaacaatatccagataggggggttatttcctaatcaacagtcccaggaacatgct
gcttttaggtttgcgctgtctcagctcacggaaccccctaagctccttccccagatcgac
attgtgaacattagcgacagctttgaaatgacatacaccttttgctcacagttctccaag
ggcgtctatgccatctttggtttttatgagaggaggactgtcaacatgctcacatctttc
tgcggggctctccacgtctgcttcataacgcccagcttccccgtcgaaacgtccaaccag
tttgttctccagcttcgcccagagctccaggatgccctcatcagtgtcatcgaacactac
agctggcagaagtttgtgtacatttatgacgctgatcggggattgtcagtcctacagaaa
gtgctggacactgcagccgaaaagaactggcaggtgacagctgtcaacatcctgacgaca
acagaagagggctaccgcatgctcttccaggagctggagaagaagaaggaaaggctggtg
gtggtggactgtgaatctgagcggctgaacatcatcctcagcaagatcatcaagcttgaa
aaaaatgggaatggataccactacatcttggcaaatctgggatttatggatattgatctg
acaaaattcaaggagagtggagccaatgtaactggattccagttggtgaattacacggat
gctgttcctgccaggatcatgcagcagtggaggaataatgatgccagggagcatcctcgt
gtggactggaaaagaccaaagtacacatcggcccttacatacgatggggtccgggtgatg
gctgaggcgtttcagaacctgcggaggcagcggattgacatctcccgtcgcggcaatgcc
ggggactgccttgccaaccctgccgtgccctggggacagggcatcgacatccagagagcg
ctgcagcaggtccgtttcgaaggactgtctggcaacgttcagtttaatgagaagggacgc
aggaccaactacaccctccatgtgattgagatgaaacacgatgggatcagaaagattggc
tattggaatgaagatgaaaagttggttccagcagccatagatactcaaaccggcaatgag
tccacgagcctccagaacaggacttacatagtcacaactatcctagaagacccatacgtc
atgctcaagaagaatgccaaccagtttgaaggcaacgagaggtatgaaggctactgtgtg
gagcttgctgctgagattgcaaagcatgttggctaccactacaggctggagattgtcaga
gacgggaagtacggagcccgggaccccgacaccaaaacgtggaatggcatggtgggagaa
ctcgtgtatgggagagctgatgtggctgtggcaccactaaccatcactctggttcgagaa
gaagttatagacttttccaaaccatttatgagtttaggtatctctatcatgataaaaaaa
cctcagaagtccaaaccaggagtgttttcctttctggatccgttggcttacgaaatatgg
atgtgcattgtttttgcctacattggagtgagtgttgtcctcttcttggtgagccgcttc
agcccttatgagtggcacacagaggaatttgaggaaggacgggaccagccagccaatgat
cagacgaatgagtttgggatattcaacagtctctggttctccctgggagctttcatgcag
caaggatgtgatatttctccaaggtctctctccggccgcatagtcggtggcgtctggtgg
ttcttcaccttgatcatcatatcctcctacacagctaacctggctgccttcctcacggtg
gaaaggatggtttctcccatcgagagtgcagaggacttggccaagcagacggaaatcgcc
tatgggaccctggaagctggttccactaaagagttttttaggcgatccaaaatagcagtg
tttgagaagatgtggacatacatgaagtcagccgaaccctctgtttttgtgaggacgacg
gaagaggggatgatccgggtgaggaagtcgaaagggaagtatgcctacctcttggagtcc
accatgaacgagtacatcgagcagcggaagccctgtgacaccatgaaggtgggaggtaac
ttggactccaaaggctatggcattgcaacgccaaaggggtctgcactgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacgagcgct
ctgagtctcagcaatgtggcgggggttttctatatcctcatcggtgggctcggactagcc
atgctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaagcggatgaag
ggtttttgtttaatcccacagcaatcaatcaacgaagccatacggacatcaacccttccc
aggccggctgcagcaggaggcagtggagaaaacggacgtgtggtcagccacgatttcccc
aaatccatgcagacgatcccgtgcatgagccacagcaccggcatgtccctgggagctacg
ggattataa

DBGET integrated database retrieval system