KEGG   Anas platyrhynchos (mallard): 101804294Help
Entry
101804294         CDS       T02816                                 

Gene name
NMNAT3
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00760  Nicotinate and nicotinamide metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101804294 (NMNAT3)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     101804294 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     101804294 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like DUF2513
Motif
Other DBs
NCBI-GeneID: 101804294
NCBI-ProteinID: XP_012963279
Position
9
AA seq 355 aa AA seqDB search
MPLTTEMQAVELSLGSVNSLALSSSASVCVRLRGVQGVLGTQELYCLVIIGNYRLKSFPR
GISESELQSNHPRHLFQAGIVVLMSMKSRIPLILLACGSFNPITNMHMRLFELARDHLHQ
TGRYQVIEGIMSPVNDDYRKKGLVPARYRVAMAKLALETSDWIRVDPWESEQETWTETVT
VLRHHYNESLRLLQYKKEFIKNKQPLEGSTENSLSSHYTVLPELKLLCGADFLQTFQTPN
LWKKEHVKEIVEKFGLVCISRAGSDPAQYISESELLTKFHHNIFLVKEWIQNEISATQIR
YALCRGLSVKYLVPDSVISYIAHHNIYTEESERKNEGDLLQPLRLHNTTVSPLND
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaactacagaaatgcaggctgtagaattgagcttaggttcagtaaactcgtta
gcgctcagctcgtctgcgagtgtttgtgtaaggctcaggggtgtgcaaggggtgctgggg
acacaagagctgtactgtctggttatcattgggaattacaggttgaagtccttccctaga
ggtataagtgagtcagaactgcaatcaaaccatccaaggcatctttttcaggctggaatt
gtagttttgatgtcaatgaagagcaggatacctctcattcttctagcttgtggctccttt
aaccccatcacaaatatgcatatgcgtttatttgagctggctagagatcacctgcaccaa
acaggaagataccaagtgatagaaggcataatgtctcctgtcaatgatgactacagaaag
aaaggcttggttccagcaaggtaccgggtagcaatggcaaaactagcactggagacatct
gactggattcgagttgatccgtgggagagcgagcaggagacgtggacagagacagtaaca
gtgttaaggcaccattacaatgaatcgctcagactgctgcagtacaagaaggaattcata
aagaacaaacagcccttagaaggatctacagagaattccctttcttcccactacacagtt
ctaccagaattaaagctgctttgtggggctgattttctacagacatttcagacacccaat
ctttggaagaaagagcatgtcaaagaaattgtggagaagtttgggttggtctgtataagc
cgtgctggctctgatcctgctcagtatatcagtgaatcagaacttttaactaaatttcat
cacaatatctttctggtgaaagaatggattcagaatgaaataagtgcaacacagatacgt
tatgccttgtgcagaggattaagtgtaaaatatcttgtcccagattctgtcatatcctac
attgcacaccataatatctacacagaagaaagtgagcggaagaatgaaggtgacttgctt
cagcctcttcggttgcataacacaacagtaagcccactaaatgactga

DBGET integrated database retrieval system