KEGG   Anas platyrhynchos (mallard): 101805286Help
Entry
101805286         CDS       T02816                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101805286 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:apla03041]
    101805286 (DHX8)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101805286 (DHX8)
Spliceosome [BR:apla03041]
 Complex C
  Other components
   Step II factors
    101805286 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE PRP38_assoc AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 ABC_tran Presenilin Spem1
Motif
Other DBs
NCBI-GeneID: 101805286
NCBI-ProteinID: XP_005026168
Ensembl: ENSAPLG00000002788
Position
28
AA seq 1192 aa AA seqDB search
MADLVALEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKAVLMK
NGAEFTDSLISNLLRLIQTMRPPSKPTTSKETIVKPKSEKERLKELFPALCRPDNPNIRN
MLDEDDVKVAADALKELEALMPSADRQGKQRNSDHRTKKKRRSRSRSRDRRRRHRSRSRS
RSRTRDRNRGKSRYRSRSRSRSPSRDRRDREKYLEKGSERWRDKHVDRPPPEEPSIGDIY
NGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTG
SKTSLSMKDVDQDTGEDLNPNRRRNLVGETNEETSMRNPDRPSHLSLVNAPEVEDDTLER
KRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPF
LRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNTH
WVDPLPDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLPIF
RLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAK
RVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAH
ERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILY
TKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELI
ILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSK
TGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLAST
VLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPM
LCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAV
YNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAIC
SGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTI
DPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggtggctctggaggagctcgccaagctcgagtacctgtcgctggtctcc
aaggtgtgcacggagctggacaaccacctgggcatcaacgacaaggatttggccgagttt
gtcataagccttgctgagaaaaacactacgtttgacacatttaaagctgttcttatgaag
aatggtgccgagttcacagattcccttattagtaatttgctccgtctcatacagacaatg
cggcctccatcaaaaccaactacaagtaaagagaccattgtcaaacccaaatcagaaaag
gaaaggttgaaggagttgtttccagctctttgcaggccggacaatcccaacataaggaat
atgctggatgaagatgatgtgaaagtggcagctgatgcgcttaaagaacttgaagctctg
atgcctagtgcagacaggcaaggcaaacagaggaacagtgaccaccggacaaagaagaag
aggagaagccgaagccgtagcagggacaggagacgaaggcacagatctcgctctaggtct
cgttcaaggactcgggataggaacaggggaaaatccagataccgctcacggagcaggagt
cggagtcctagtagggaccggagggatcgagagaagtatctcgagaaaggcagtgagaga
tggagggacaagcacgtagaccgtcctccacctgaggagccttccatcggagacatttac
aatgggaaagtcacgagtataatgcagtttgggtgctttgtgcagctggaaggactaagg
aagcgttgggagggcttggtccacatctcagagcttcgaagagaaggacgggttgccaac
gttgccgatgttgtgagcaaaggacaaagagtaaaagtcaaagtgttatcctttactgga
tccaaaaccagcctgagcatgaaggatgttgatcaagatactggggaagacttgaatcca
aaccggaggaggaacctggttggagaaaccaatgaagaaacttcaatgagaaacccagac
agacccagccatctgtccctggtgaatgccccagaggtggaggatgacaccctggaacgg
aaacgcctcacccgaatttcagacccagagaaatgggaaataaaacagatgattgcagct
aatgtgctttctaaggaagagtttcctgactttgatgaggagactgggattcttcctaaa
gtcgatgatgaagaagatgaggatcttgagattgagttagttgaagaagagccacctttc
cttcgtggtcatactaaacaaagcatggatatgagtcccatcaaaatagtaaagaatccg
gatggttccttgtcccaggctgcaatgatgcagagtgctttagctaaagaaagacgagaa
cttaaacaagcacaaagagaagcagagatggattctattcccatgggtctcaacacacac
tgggtggatcctctccctgatgtggatggaagacaaatagctgcaaacatgcgaggtatt
gggatgatgcccaatgatatcccagagtggaagaaacatgcatttggtggcaacaaagcc
tcttatggtaagaagacacagctttctatcattgagcagagagagagtctcccaatcttc
agactgaaggagcagctgatacaagctgtgcatgacaaccagattctgattgttattgga
gagacagggtctgggaagacaacccagattacccagtacctggctgaggcgggatataca
tcaagaggaaagatcggatgtactcagcctcgcagagtggccgcgatgtctgttgcaaag
agggtgtcagaggagttcggttgctgtttgggacaagaggttggctacaccattcgattt
gaagactgcactagccctgaaactgtcatcaaatacatgacagatggtatgttactgagg
gagtgcttgatagatcctgatctgacccagtatgccattattatgctggatgaagcccat
gagaggacaattcatacagatgtgctctttggactcctgaagaagacggtacagaaacgg
caggatatgaagttgatagtgacgtcggcgacactggatgctgtgaaattctctcaatat
ttctatgaagctccaatcttcacaattcctggcagaacatacccagtagaaatcctgtac
acaaaagagccagagacagattatttggatgctagtctgattacagtaatgcagatccac
ttaacagagccaccaggtgacatcttggtatttctaactggtcaggaagagatcgacact
gcctgtgagatcctctatgagaggatgaaatctctaggacctgatgttccagagttaatt
atcctgccagtatattcagctttacccagtgaaatgcaaaccaggatctttgacccagcc
ccaccaggaagcagaaaggttgtcattgccactaacattgctgagacatcacttactatt
gatggaatatattatgtggttgatcctggctttgtgaagcaaaaagtttacaactccaaa
actggaatcgaccagctggttgttacaccaatttcacaagctcaagcaaagcagcgagca
ggaagagctgggagaacagggccaggaaaatgctataggctgtatacagagcgtgcctat
cgagatgaaatgctaaccaccaatgtgcctgaaatccagagaacaaatttggccagtaca
gtgctctccctgaaggccatgggcatcaatgatttgctctcctttgactttatggatgca
cccccaatggaaactctcataactgccatggagcagctgtacactctgggagctctggat
gatgaaggacttctcactcgacttgggcgcaggatggcagaattccccttggagcccatg
ttgtgcaagatgttgatcatgtctgtacatctgggatgcagcgaggaaatgctgaccata
gtctccatgctgtctgtacagaatgtgttctacaggccaaaggataaacaagcacttgct
gatcaaaagaaagccaagttccaccagacggaaggagaccacctcactctgctggctgtc
tacaattcctggaagaacaataagttttcaaatccctggtgctatgaaaattttatccaa
gcccggtccttacgcagggcacaggacatccgcaagcagatgttgggcattatggacaga
cacaagctggatgtggtgtcctgtggcaaggcaacggttcgagtccagaaggccatctgc
agcggtttcttcagaaatgctgcaaagaaggatccccaggagggttatcggacactcatt
gatcaacaggtggtctatatccacccatccagtgctctcttcaacagacagcccgaatgg
gtggtgtatcatgagctagtgctgaccaccaaggagtacatgcgtgaagtgacaactatt
gacccacgctggctggtggaatttgcaccagcattcttcaaggtttctgatccaaccaaa
ctgagcaaacagaaaaagcagcagcggcttgaacccctctacaaccgctacgaggagccc
aacgcttggaggatatcacgtgcattcagacggcgatga

DBGET integrated database retrieval system