KEGG   Anas platyrhynchos (mallard): 113841036Help
Entry
113841036         CDS       T02816                                 

Gene name
BLVRB
Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00740  Riboflavin metabolism
apla00860  Porphyrin and chlorophyll metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    113841036 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    113841036 (BLVRB)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     113841036 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     113841036 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 113841036
NCBI-ProteinID: XP_027303567
Position
Unknown
AA seq 102 aa AA seqDB search
HPVAFLLWDLQKVPPRLLPVTEDHVRMHRVLQDSGLDCVAVMPPHIADDQPLTGDYAVSV
GATAGGSRVISKHDLGHFMLRCLHTSEYDGKGVYVCGHYPKA
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
caccccgtagccttcctgctgtgggacctccagaaggtgccaccgcggctgctgccggtg
accgaggaccacgtccgcatgcaccgggtgctgcaggactcggggctggactgcgtggcc
gtgatgccaccgcacatcgccgacgaccagccgctgaccggggactacgccgtgtccgtg
ggggccaccgcggggggctcccgcgtcatctccaagcacgacctcggccacttcatgctc
cgctgcctccacacctcggagtacgacgggaagggcgtctacgtctgcggccactacccc
aaggcctag

DBGET integrated database retrieval system