KEGG   Anas platyrhynchos (mallard): 113845028Help
Entry
113845028         CDS       T02816                                 

Gene name
CAMK1
Definition
(RefSeq) LOW QUALITY PROTEIN: calcium/calmodulin-dependent protein kinase type 1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113845028 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    113845028 (CAMK1)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     113845028 (CAMK1)
Protein kinases [BR:apla01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   113845028 (CAMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Tyrosinase RIO1 APH YrbL-PhoP_reg FTA2
Motif
Other DBs
NCBI-GeneID: 113845028
NCBI-ProteinID: XP_027323161
Position
13
AA seq 370 aa AA seqDB search
MPLGRDGPGWKKRTEDIHRIYDFREVLGTGAFSEVVLAEEKATQKLVAIKCIAKKALEGK
EAGLENEIAVLHKIKHPNIVALDDIYESSSHLYLIMQLXGVGGGLFDRIVEKGFYTERDA
SALIRQILDAVRYLHDMGIVHRDLKPENLLYYSLEEDSKIMISDFGLSKIEGCGSVMSTA
CGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILRAEYEFD
SPYWDDISDSAKDFIRHLMEKDPKKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF
AKSKWKQAFNATAVVRHMRKLQLGTSQEGPAQPPLSSPCHGQRLGGASSNAGSDCERAPV
VNRPPRLPPH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggggcgggacgggcccggctggaagaagcggaccgaggacatccaccgaatt
tacgacttccgagaggtcctgggcacgggggccttttccgaggtggtcctggcggaggag
aaggcgacccagaagctggtggccatcaagtgcatcgccaagaaggcgctggaggggaag
gaggccgggctggagaacgagatcgccgtcctgcacaagatcaagcaccccaacatcgtg
gccttggatgacatctacgagagcagcagccacctctacctcatcatgcagctgtgaggt
gtcggggggggactcttcgaccgcatcgtggagaagggcttctacaccgagcgcgacgcc
agcgccctgatccggcagatcctggacgccgtcaggtacctgcacgacatgggcatcgtg
caccgagacctcaagcccgagaacctgctgtactacagcctggaggaggactccaagatc
atgatcagcgacttcgggctctccaagatcgagggctgcggcagcgtcatgtccaccgcc
tgcgggacccccggatacgtggcccccgaggtgctggcgcagaagccctacagcaaggca
gtggattgctggtccatcggggtcatcgcctacatcctgctgtgcgggtaccccccgttc
tacgacgagaacgacgccaagctcttcgagcagatcctgcgagccgagtacgagttcgac
tcgccctactgggacgatatctcggactcggccaaagacttcatcaggcacttgatggag
aaggaccccaaaaagcgcttcacgtgcgagcaagccctgcagcacccctggatcgccggg
gacacggccctggacaagaacatccaccagtcggtgagcgagcagatcaagaagaacttc
gccaagagcaagtggaagcaagccttcaacgccacggccgtggtgcggcacatgaggaag
ctgcagctgggaaccagccaggagggccccgcgcagcccccgctgagcagcccctgccac
ggccagcgcctggggggggcctccagcaacgcagggtcggactgcgagcgggcgccggtg
gtgaacagacccccccggctgcccccacactga

DBGET integrated database retrieval system