KEGG   Acanthaster planci (crown-of-thorns starfish): 110973380Help
Entry
110973380         CDS       T05078                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110973380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aplc03041]
    110973380
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110973380
Spliceosome [BR:aplc03041]
 Complex C
  Other components
   Step II factors
    110973380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Microtub_bd AAA_16 Presenilin PhoH
Motif
Other DBs
NCBI-GeneID: 110973380
NCBI-ProteinID: XP_022079861
Position
Unknown
AA seq 1210 aa AA seqDB search
MEELDKLEYLSLVSKVCTELDNHLGMNDKDLGKCNIHLHDXYCFSSALQKNGADLPQSFV
SNLLRLIQHMRPPKQAKTANEAKEKKPKVSELDKRRKKYPGLCLPDKKGEVETDEKVAQD
AMDELEALMPLAKMPIKTEKSEDVKTHKKKKNRHHRRSRSRSRSRSSSHDRDRARERRKR
RSWSKSRSRSRDRDRRRRSRSDSRERDSGKDRKHRRKRDRSRDRNRDRDWDKHKDSGSHA
DRFVNRPPPMDPEVGCIYDGKVTSVMQYGCFVQLEGLKRRCEGLVHISELRREGRVADVN
DVVTRGMKVKAKVLSLAGTKIRLSMKDVDQDTGRDLNPMMSKGLAGSSNPEADDALRNPD
RPSNLPLVSVPETDDVSIRKRVQRTTSPEKWELKQMMAANCIDVTELPDFDETTGVLAKE
DDSDEEIEIELREEDPPFLQGHGRQSVELSPVRIVKNPDGTLSKAAMMQSALAKERREMK
QAAERAESENIPTGMNKNWIDPMPDSERALVANVRNMGFTNQDMPEWKKSAFGGNKASYG
KRTKMTIMEQRESLPIFKLKEQLVQAVLDNQILVVIGETGSGKTTQITQYLAEAGYTVRG
KIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECL
IDSDLTQYAIIMLDEAHERTIHTDVLFGLLKKAVKKRSDLKLIVTSATLDAVKFSQYFFE
APIFTIPGRTFPVEILYTKEPEADYLDASLITVMQIHLTEPPGDVLLFLTGQEEIDTACE
ILFERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGI
YYVVDPGFVKQKVYNSKTGMDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDE
MLTTAVPEIQRTNLASTLLSLKAMGINDLLAFDFMDAPPTETLITAMEQLHSLSALDDEG
LLTRLGRRMAEFPLEPMLSKVLIMSVHLGCSEEILTIVSMLSVQNVFYRPKDKQAIADQR
KAKFQQPEGDHLTLLAVYNSWKNNKFSNPWCFENFVQARTLRRAQDVRKQLLGIMDRHKL
DVVTCGKNTARVQKAICSGFFRSAAKKDPQEGYRTLVDSQIVYIHPSSALFNRQPDWVVY
HELVLTTKEYMREVTTIDPRWLVEFAPSFFRVADPTKLSKHKKQQRLEPLYNKYEEPNSW
RISRQRLRRN
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactggacaagcttgaatatctctccctggtatccaaagtctgtaccgagttg
gataaccatcttgggatgaatgataaagacctaggtaagtgtaatatacatttacatgat
tgatactgtttttcatcggccctccaaaaaaatggcgccgatctgccccagtcatttgtc
tccaacctgctgcgtctcatccagcacatgaggccgcccaagcaggccaagacagccaac
gaggccaaggagaaaaagcccaaagtcagtgaactggacaagcggcggaagaaatacccg
ggcctctgcctaccggataagaagggagaagtcgaaacggacgagaaagtggcgcaggac
gcgatggacgagctggaggcactgatgcctttggccaaaatgccaatcaaaaccgagaag
tctgaggacgtgaagacacacaagaaaaagaagaatcgacatcacagacgtagccgtagc
cgcagtcgcagcaggagttcaagccacgacagggaccgggccagggagagacgcaagagg
cggtcgtggtccaaatcacggtcgcggagtcgggaccgggaccggcggcgccgcagtcgc
agtgacagtcgggaacgggacagcgggaaagatcgcaagcacagaaggaaaagggacaga
agcagggaccgcaatcgggaccgtgactgggacaagcacaaggacagcggcagccacgcc
gaccgctttgtcaaccggcccccacccatggacccggaggtgggctgcatctacgacggg
aaagtcaccagcgtcatgcagtatggctgttttgtccagctggagggccttaaacgcaga
tgcgaggggcttgtgcacatctccgagctgcgccgcgaaggacgagtggcagatgtcaac
gacgtggtgacccggggcatgaaggtcaaagccaaagtcctatccctagcagggaccaag
atccggctgtccatgaaagatgttgaccaggacacaggcagggacctcaatccgatgatg
tccaagggtctcgccggctcctccaacccggaagcggacgacgccctgcgcaatcccgac
cgcccctccaacctgcccctagtctcggtgccggaaaccgacgacgtcagcatccgcaag
cgggtccagcgcactacctcgcctgagaagtgggaactgaagcagatgatggcggcgaac
tgtattgatgtgaccgagctcccagactttgatgagaccacgggcgtcctagctaaggaa
gacgactcggatgaggagattgagatcgagctgagggaggaggacccgcccttcctgcag
ggccacggccggcagagcgtcgagctcagccctgtccgaatcgtcaaaaacccagacgga
acgttgtccaaggctgccatgatgcagagcgccctcgccaaagagcgtcgagagatgaag
caagcggctgagcgtgccgagagtgagaacatcccaacgggaatgaacaagaactggatc
gatcccatgccagacagcgagcgcgccttggtggccaatgtgcgcaacatgggattcacc
aaccaggacatgcctgaatggaagaagagcgcgtttggcggcaacaaagcgtcgtacggt
aaacgcaccaagatgacaatcatggagcaacgtgagagtctgcccatcttcaagctgaag
gaacaacttgtgcaggccgtgctggacaaccagatcctggtggtcattggggagacgggc
agcggtaagaccacccagatcacccagtacctggccgaagctggctacaccgtccggggg
aagatcggctgcacccagccccgccgcgtggctgccatgtccgtggccaagcgagtgtcg
gaggagtttggctgccggctgggtcaagaggtgggctacaccatccgttttgaggactgc
acttccccggagaccaagatcaagtacatgacagacggtatgctactcagagagtgcctg
atcgactcggacctcacccagtatgccatcatcatgctggacgaggcccacgagcgcacc
atccacacggacgtcctctttggcctgctcaagaaggccgtcaagaagcgcagcgacctg
aagctgatcgtaacctcggccacgctcgacgccgtcaagttctcccagtacttcttcgag
gcgccaatctttacaatcccgggccgcaccttccccgtggagatcctatacaccaaggag
ccagaggcagactacctggacgcctccctcatcacggtcatgcagatacacctgaccgaa
ccgccgggagatgtgctgttgttcctgactggtcaggaggagatcgacacggcctgcgag
atcctctttgaaaggatgaagtccctgggtccagaggtaccagagctgatcatcctacca
gtctattccgccctgcccagcgagatgcagaccaggatatttgacccagctcctccgggg
agcaggaaggttgtcatagccaccaacattgccgagacctcactgaccatcgacggcatc
tattacgtggtggatccaggctttgtcaagcagaaagtctataactccaagaccgggatg
gaccaacttgtcgtcactccgatatcgcaggctcaggccaagcagcgcgcgggccgcgcc
ggccgcacgggccccggcaagtgctaccgcctctacacggaacgggcctaccgcgacgag
atgctgaccaccgccgtgcccgagattcagcgcaccaacctggccagcacgctgctctcc
ctcaaggccatgggcatcaacgacctgctggccttcgacttcatggacgctcccccgacc
gagacactcatcacagccatggagcagctgcactcgctcagcgcactggacgacgagggc
ctgctgaccagactcggacgcaggatggcagagtttcctctagagcccatgctgtccaag
gtcctgatcatgtccgtccatctgggatgtagtgaagagattttgaccattgtctccatg
ctgtctgtgcaaaatgtcttctacagacccaaggacaagcaagcgattgccgaccagcgt
aaggccaagttccagcagcctgagggggaccacctgaccctgctggccgtctacaactcc
tggaagaacaacaagttctccaatccctggtgcttcgagaactttgtgcaggcgcggacg
ctgcggcgggcccaggacgtcaggaagcagctgctaggaatcatggatcggcacaagttg
gacgtcgtgacgtgcggcaagaacacggcccgagtacagaaggccatctgcagcggtttc
ttccgcagcgccgccaaaaaggatccgcaagagggttatcgtactttagtggacagccag
attgtctacatccatccatccagtgcacttttcaaccggcaaccagactgggtcgtctac
cacgagctggtcctgaccaccaaggagtacatgcgggaggtgaccaccattgacccccgc
tggctggtggagtttgccccttccttcttccgggtggccgaccccacgaagctgagcaag
cacaagaagcaacagcgactggagccgctctacaacaagtacgaggagcccaactcctgg
cgaatctcccgccagcggctgcgacgaaattag

DBGET integrated database retrieval system