KEGG   Acanthaster planci (crown-of-thorns starfish): 110974054Help
Entry
110974054         CDS       T05078                                 

Definition
(RefSeq) monoglyceride lipase-like isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00561  Glycerolipid metabolism
aplc01100  Metabolic pathways
Module
aplc_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aplc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    110974054
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110974054
Peptidases [BR:aplc01002]
 Serine Peptidases
  Family S33
   110974054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Lipase_3 Esterase Thioesterase PGAP1 LCAT OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 110974054
NCBI-ProteinID: XP_022081070
Position
Unknown
AA seq 299 aa AA seqDB search
MAKCEKLSPQGTPYSSLAHFVNADGQYIYCKYWEPPTGTPVRALLCLVHGMGEHCERYNK
LAQQFNNIGILVFTHDHIGHGKSEGSRVDIKHFQFFVRDCHQHIDLMKSKYEDLPVFLFG
HSMGGTIAILVAYERPSLFTNTGVLLSAPAIKASPEIATPTKLFLGKILASIWPHAPMGQ
LESSSMSRDPEVVKDYETDPLIFHGKIKARFAVQTLQAMERLGNGLPDIRWPFLIQHGDQ
DKLAEISGSRLMYETAPSEDKTLTVYEGFYHELDKEPGGDGEKTIQELLDWVLQRLPSQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtgtgaaaagttgagtccgcaaggcacaccttactcaagtttagctcatttt
gtgaacgcagatggacagtacatttactgcaagtactgggaaccacccaccggcacacct
gttagggccttgctgtgccttgtccatggcatgggtgaacattgtgaacggtacaataaa
ttagctcaacagttcaacaacattggaattctggtttttacacatgatcacattggccac
ggcaagagtgaagggtcgagggttgatatcaaacatttccagttctttgtccgtgattgt
caccagcacatcgacttgatgaagtccaaatatgaggaccttcccgtcttcctgtttgga
cattccatgggagggaccatagcaatactggtggcatatgagaggccgtcactctttacc
aacaccggagtcttgctgagtgctccagccatcaaggctagcccagaaatagccactccc
acgaagcttttcctaggcaagattctggccagtatttggccccatgctcccatgggtcag
ctggaatcctcctcaatgagtagggaccctgaagtggtcaaagattacgagactgacccc
ttgatcttccacggtaagatcaaggcccgctttgctgtccagacgctgcaggcgatggag
aggcttgggaacgggctgcctgacatccgatggccatttctcatccagcatggcgaccag
gacaagctggcagaaatctctggctccaggctcatgtacgagacggcgcccagtgaagac
aagacattgacagtgtacgagggcttctaccatgagctggacaaagaacctggcggggat
ggagagaaaacgatccaagaactcttggactgggtcttgcaaagactgcccagccagtga

DBGET integrated database retrieval system