KEGG   Acanthaster planci (crown-of-thorns starfish): 110974483Help
Entry
110974483         CDS       T05078                                 

Definition
(RefSeq) cyclin-dependent kinase 8-like
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aplc01001]
    110974483
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aplc03021]
    110974483
Enzymes [BR:aplc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110974483
    2.7.11.23  [RNA-polymerase]-subunit kinase
     110974483
Protein kinases [BR:aplc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110974483
Transcription machinery [BR:aplc03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     110974483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 110974483
NCBI-ProteinID: XP_022081846
Position
Unknown
AA seq 489 aa AA seqDB search
MDYEFKMRTASMREKVEDLFDYEGCKVGRGTYGHVYKATTKKGNPKKEYALKQIEGTGIS
MSACREVALLRELKHPNVISLRKVFLSHADRKVWLLFEFSEHDLWHIIKHHRANKANKKG
PASVPPSMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGECSERGRVKIADMGFARL
FNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQE
DIKTSNPYHHDQLDRIFNVMGFPQGNMDMKHRLHHPTLRTSQIDPYTNCCLVKYMEKHKI
KPDCRAFQLLSKLLTMDPTKRMTAKQSMEDPYFTEEPLPTADVFDGKPIPYPKREFLTDE
ENEDKSDTSKAGSSSHLQTHHRMRLAQQAASQARSTGGSSSHAQGAKRMRVAASASSQGG
APGGGMMQNDYQAQQVKKHMMPGYQQSGTTQTSGTATSKQQQGMMYTSNTVQSNSGSYSQ
QHQQHQHRY
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggattacgagttcaagatgcgcacggccagcatgcgggagaaagtagaggacctgttt
gactatgaggggtgcaaagtgggacggggaacctacggacatgtctacaaagctacaacg
aagaagggaaatccaaagaaggaatatgccctaaaacaaattgagggaaccgggatatct
atgtcggcatgtcgggaagtcgctctgctaagagagctgaagcatcccaacgtgatcagt
ctacgtaaagtgttcctgtcacatgccgacagaaaagtatggctcctctttgaattctca
gagcacgatctatggcacatcataaagcatcatagagccaataaggcaaacaagaagggt
ccagcgtctgtaccgccctctatggtcaagtcactgctctatcagatcctagatggcatt
cactatctacattccaactgggtgcttcacagggacttgaagccagccaacattttagtc
atgggagagtgttcggaacggggtcgggtcaagatagctgacatgggttttgccaggctg
ttcaactctcctcttaagcccctggctgatcttgaccccgtagtggtcaccttctggtac
cgagcgcctgagctgctcttaggggcgagacactacaccaaagcaatagatatatgggcc
atcggctgcatctttgccgagctcttgacctctgaacccattttccactgccgacaggag
gatatcaagaccagcaacccctaccatcatgaccagctggacagaatcttcaacgtcatg
ggatttcctcaaggtaatatggacatgaagcaccgactgcaccaccctactttgagaacc
agccagatagatccttatacaaactgctgtcttgtcaagtacatggagaaacacaaaatc
aaaccggactgtagagctttccagttgctatctaaactattaacgatggatccaaccaaa
cgcatgacggccaagcagtcgatggaggatccctacttcactgaagagcctttaccaaca
gcagacgtgtttgacggcaaacctattccctaccccaagcgggaattcttaacagatgaa
gaaaacgaagacaaatcggacaccagtaaggctggatcatctagtcatttgcagacgcat
catcgcatgcgcctagcccagcaggcagctagtcaggcacgcagtacgggtggttcgtca
agccacgcccagggggccaaacggatgcgggtggcagcctcggcgtccagccaaggtggg
gcaccaggcggtgggatgatgcagaatgactaccaggcacaacaggtaaagaagcacatg
atgccgggctatcagcaaagcggaaccacgcagaccagtggcacggcaacctccaaacaa
cagcaggggatgatgtacacgtccaacactgtacagagtaacagcgggtcatacagccaa
cagcaccagcagcatcagcacaggtactga

DBGET integrated database retrieval system