KEGG   Acanthaster planci (crown-of-thorns starfish): 110977508Help
Entry
110977508         CDS       T05078                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00010  Glycolysis / Gluconeogenesis
aplc00562  Inositol phosphate metabolism
aplc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110977508
   00562 Inositol phosphate metabolism
    110977508
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110977508
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110977508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110977508
NCBI-ProteinID: XP_022087423
Position
Unknown
AA seq 532 aa AA seqDB search
MTKFSWLLRTGLLLALLGTLRAQDPLFATETGYDLSFQRNELNQRTLSWRDLARATGGSP
PEGLQNCQPAGSYVVYRAGTSFPAEADIGALSALQAKMRRQTVNPSFRFLSQLSTSRIPR
TSAGDLAESGRRELQELASRIKVRFQEFFQNPDVDLGRFSFQSTNASKSIDSAVAFVRGL
VGLNQICETLSSEGNVTVTCSENSRQSPRIVTPTSAYIPHDPANMDPLLRPYNTRRRCLD
TVNKGKTAREVRNFQRSREAMQLKDRVAKRLSVPGAQQLWNITTDEVELLGRICAYYLAM
FNENTTWCRLLEYEDLNVAEYRRELEDFWDKSYGFPLNSRVTCPLINDTLEYFDRLSGRA
AGAGVRTPLMIFKFADENTLLRLVSLLGIAKDPRPLMFNNYAQSRTRQFRTAKLAPFAGN
LALNLFRCEEPQSLFFEDVTFRVQVLLNERPINITFCQDAFCNLRDFRRELMAKAGQCQV
QADCNVAFGLNPDGSRPGPGSGGGRGAASTVTPARLLIALAAIIVAKVILVA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagttcagctggcttcttaggacgggcctgttgctggcgctccttgggacgctt
cgtgcccaagatccgctgtttgccaccgagaccggctacgatttgtccttccagcggaat
gagctcaaccagcgcaccctgtcctggcgggaccttgcccgggccacgggcggctcgcct
cccgaagggctgcagaactgccagccggctggctcttacgtcgtctatcgcgcgggcact
agcttcccggccgaggcggacatcggtgcgcttagcgccttgcaggccaagatgcgccgg
cagaccgtcaacccgtcgttccggttcctctcgcagctgtccaccagccgtatcccgcgg
accagcgccggcgacctcgctgagtccggccggcgggagctgcaggagctggcctcccgc
atcaaggtccgcttccaggagttcttccagaacccggacgtcgacctgggcaggtttagc
tttcagtccaccaacgcgtccaaaagcatcgacagcgccgtggcgttcgtccggggtctg
gtcggcctgaaccagatctgcgagaccctgtcgtccgagggcaacgtcaccgtgacctgc
tcagagaacagccggcagtcgccgcgaatcgtcaccccgacctccgcctacatcccccac
gatcccgccaatatggaccccctacttcgcccttacaacacccgaaggcgatgcctcgat
accgtcaacaagggcaagacggccagggaggtcaggaactttcaaagaagcagagaggca
atgcagctcaaagaccgcgtcgctaagagactctccgtacctggggctcaacagctgtgg
aacatcacgacagatgaggtggaacttttgggaagaatctgtgcctactacctggccatg
tttaacgagaacaccacctggtgccgtctcctcgaatacgaagacctgaacgtggccgag
taccggcgagagctggaagacttctgggacaaatcctacgggttccctctcaactcgcgg
gtgacgtgtccgctcatcaacgacacgctggagtacttcgataggctgtctggcagggca
gctggagctggagtacgtacacctcttatgattttcaagtttgccgatgagaacacctta
ctccgactcgttagcctgctgggaatagccaaggatcctcggccactgatgttcaacaac
tacgcccagagccgcacccggcagttccgcacggcgaagctcgccccctttgccggcaac
ctggcgctcaacctgttccgctgcgaggagccgcagtcgctcttcttcgaagacgtcacc
ttccgggtgcaggtactgctcaacgagcggcccatcaacatcaccttctgccaggatgcc
ttctgcaacctcagggacttcaggcgggagctgatggctaaggcgggccagtgccaggtg
caggcggactgcaacgtggccttcgggcttaacccagacggttctaggcccggaccgggc
agtggcgggggccgcggagccgcgtccactgtcacacccgctcgactgttgatagctctt
gctgcaatcattgtggccaaagtaatacttgtagcatag

DBGET integrated database retrieval system