KEGG   Acanthaster planci (crown-of-thorns starfish): 110979227Help
Entry
110979227         CDS       T05078                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 1-like isoform X1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110979227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aplc03032]
    110979227
   03036 Chromosome and associated proteins [BR:aplc03036]
    110979227
   03400 DNA repair and recombination proteins [BR:aplc03400]
    110979227
Enzymes [BR:aplc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110979227
DNA replication proteins [BR:aplc03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110979227
Chromosome and associated proteins [BR:aplc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    110979227
DNA repair and recombination proteins [BR:aplc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     110979227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP PADR1 WGR BRCT PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 110979227
NCBI-ProteinID: XP_022090531
Position
Unknown
AA seq 994 aa AA seqDB search
MAEENERNFPFRAEYAKSNRAGCKCCKMSIAKDRLRMAKMVQSPYFDGMQPNWYHFDCFW
KVVKGSVKSTADIGHFDALRWDDQEKIRERISASGTTAAKAKGETLEDFAVEYAKSNRSV
CKACGEKINKNDVRINYKSSIAAAAKGLPGTMDTWHHLNCFVKPDLLATVQWRDTNSVDK
IDGYKRLKTEDQKLMKEKFPTKRKARASVDEPDSKKAKVVDEEKEKLKAQSNFVWKIRDE
LKKSVAISSLKELLTANGLSVPAGESKILDRAADCMAFGPTKRCMECDNGQFALTTGGYQ
CQGNMSSWTKCTVFLQDVKRGKLIIPQDLDEEYLTKFKFKAYNGGKRIFPKEEAGAGPSG
TKKPIRDDKNPLLNLDIASAGKLDISASAVKDVVKKLGGTYVNSVSRSTACVVSNAEEVD
KMSSKIKSAKKCGVHVVALDFLTEIEKGGDVVQLIPKHSIASWGSDVEKRIGKDETDSMA
SLQQASYKSSGFGRAANKSAASGGVKKVQLKGGAAVDPESGLEDTAHVLKESGLLFSATL
GMVDVTRGSNSYYKLQLLESDGGSRYWVFRSWGRVGTGIGGKKVESFGSRKSDARRNFVD
VYTEKTGNPFGTKNFEKIPHRFYPLDIDYGDDDEIAKLGANTDVESKLHPQIQNLMKLIF
DIDTLKKTMVEFEIDMDKMPLGKLSRSQIQNAYSVLTELQTLIEAGNASRNAMLDATNRF
FTLIPHNFGFNSIPLLDTLEVIQLKTKMLDSLLEIEVAYSLLKASQGNTAKSPIDANYEK
LKCLMEVVDKDSDEFKMIETYTKNTHGATHSAYKLKVEEVFRLDRDGEKSRYKPFQKLHN
RMLLWHGSRLSNFCGILSQGLRIAPPEAPATGYMFGKGVYFADMVSKSANYCFTNRSNPT
GLMLLCEVAIGNMHELTHSSYITQLPSGKHSTKGIGGTYPDPAGQVNLENGTIVPSGIAR
SSSVYSSLLYNEYIVYDVAQIRMKYLIKMKFVYN
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggaaaacgagagaaactttccatttcgtgcggagtatgccaaaagcaataga
gctggttgcaagtgctgcaaaatgtccattgccaaagatagactgcgaatggctaaaatg
gtgcagtccccatactttgatggcatgcagccaaactggtaccactttgactgtttctgg
aaggtggttaagggctcggtgaaatcgacagccgacatcggtcactttgacgcccttcgt
tgggacgatcaggagaagatcagagagcgcatcagtgccagtggtaccacagcagccaag
gctaaaggggagacgctagaagactttgcagtagagtatgccaagtccaacaggagtgtc
tgtaaggcatgcggagagaagattaataagaatgacgtccgcatcaattacaagagctcc
attgcggcagcagcgaaaggcctgcctggtaccatggacacgtggcaccatctgaactgc
ttcgtcaagccagacctgctggccaccgtccaatggagagacaccaactctgtggacaag
attgacggctacaagagactgaagacagaagaccaaaaactgatgaaggagaagttccct
acaaagcgaaaggccagagcgtctgtcgatgagcctgattcgaaaaaagccaaagtggtt
gacgaggagaaggaaaaactcaaggctcagagtaattttgtctggaaaatcagggacgag
ctgaagaagagtgttgccatttcttcgctgaaggaactgttgacagccaatggactgagt
gtaccagctggtgaaagcaaaatccttgaccgagcagcagactgtatggcctttggcccc
accaagcggtgcatggaatgcgacaatggtcagtttgccctgaccacaggtggctatcag
tgccagggtaatatgtcctcgtggacgaagtgcacggtcttcctgcaggatgtcaagagg
ggaaagctgatcattccccaggacttggacgaggaatacctgacaaaattcaagttcaag
gcctacaatggcggcaaacgaatcttccccaaggaagaagctggagcagggccatcagga
actaaaaagcccatcagagatgataagaacccattgctgaacctggacatagcctcggcc
gggaagttggatatcagcgccagtgcagtgaaggacgttgtcaagaaattgggggggaca
tacgtaaacagtgtctcccgctccacggcttgtgtagtcagcaatgcagaggaggttgac
aaaatgtcctccaagatcaaatcggccaagaagtgcggggtgcacgtggttgccctggac
ttcctgacggaaatcgagaaagggggtgacgtggtgcagctgatccccaaacatagcatc
gcctcgtggggctcagacgttgaaaaaaggattggcaaagacgagacggacagcatggcg
tctcttcagcaagccagctacaagagctcaggctttggacgggctgccaacaagagtgct
gcctccggcggtgtcaagaaggtacagttgaagggcggagcagctgttgatcccgagtcg
ggactggaggacacggcccatgtactcaaggagagtggcttattgtttagtgcaacattg
ggaatggtggacgtcaccagaggctccaactcttactacaagctgcagctgctggagagt
gacgggggaagcaggtactgggtcttcaggtcctggggacgcgtcggcacaggtattgga
ggtaaaaaggtggagtcgtttggatccaggaaatctgatgcccgcagaaactttgtggac
gtttacactgagaagaccggaaacccttttggcaccaagaactttgagaagatcccccat
aggttctacccactggatattgactatggagatgacgatgagattgcaaagctcggagcc
aacactgatgttgaatccaagttacatccacagatccagaacttgatgaaactcatcttc
gacattgacactctaaagaagaccatggttgagttcgagattgacatggacaagatgcct
ctggggaaattatctcgcagccagatacaaaatgcctattccgtcctgacggagcttcaa
acactgattgaggcaggcaacgccagcaggaatgccatgctagatgctaccaacaggttc
ttcaccctcataccccataactttggtttcaactccattcccttgttggacaccctggaa
gtcatacagctgaaaaccaagatgctagacagtctgctggagattgaagtggcctacagt
ctcctgaaggccagccagggaaacactgcaaagagccccattgatgccaactatgagaag
ctcaaatgcctcatggaggttgtcgacaaagacagtgacgagtttaagatgatcgagaca
tacaccaagaacacccatggtgccacacacagtgcctacaaactcaaagtggaggaggtg
ttccgactagatcgggacggggagaagtcacgctacaaacccttccagaagctacacaac
cgcatgctgttgtggcacggctccagactgtccaacttctgtggtatcctgtctcagggt
ctccgtattgccccaccagaggcccctgcgacgggctacatgtttggcaagggcgtctac
ttcgccgacatggtgtccaaaagtgccaactactgtttcaccaaccgcagcaaccccacc
ggcctgatgctgctgtgtgaggtggctatcggtaacatgcacgagctgacacactcgtcc
tacatcacccagttgcccagcgggaagcacagcacaaagggtataggcggaacatatcca
gatccagccggtcaagtaaacctggagaatggcactatcgtgccttcagggattgcaaga
tcttcctctgtctactctagcctgctgtataatgaatacatcgtgtatgacgtggcacag
atccgcatgaagtatctcatcaagatgaaatttgtttacaactaa

DBGET integrated database retrieval system