KEGG   Acanthaster planci (crown-of-thorns starfish): 110979251Help
Entry
110979251         CDS       T05078                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc04068  FoxO signaling pathway
aplc04350  TGF-beta signaling pathway
aplc04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110979251
   04068 FoxO signaling pathway
    110979251
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110979251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aplc04052]
    110979251
   00536 Glycosaminoglycan binding proteins [BR:aplc00536]
    110979251
Cytokines and growth factors [BR:aplc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110979251
Glycosaminoglycan binding proteins [BR:aplc00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110979251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta Rotamase_3
Motif
Other DBs
NCBI-GeneID: 110979251
NCBI-ProteinID: XP_022090565
Position
Unknown
AA seq 445 aa AA seqDB search
MSGTGCAIWLPTEKRAVGDNVTVRSRTSRQKMSTLFPRMTSLHLGFICLALCSLLQAVTG
GSGQCKLNFQEYQNRRRSAIQAQILSKLGLTAPPTDIGPDEVPEDVLAIYNETVRILDER
REMMESVCQQAQTEEYFAKVPKVYQVDKKDHGGIYNYQTMKEQQSEFFRFDMRSYVSEVN
TDEVYEAELRLYQLPNAMKTEQQHIDVYQLIPSQSNGNPGRKHIYSTVRDTTDEGWIKID
VTQAVRDWVSIPDSNIGIEVTTPCDDTIHVLFAHPKGTMPSVKMPQRGDQQMADMSPPEQ
HPRLIVLAPANDTIGPNGASGRRTRRSTSTYGQNTCSDQTQPSCCLRQFYVNFRRDLGWG
WIRQPRGYYPNYCAGSCSYVNGSVWNAPTHHGSVLDTYRRLNPDASPSPCCSPRSFKPLH
ILFYDRGRPIFRELPNAIVTSCQCS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaactggttgcgccatttggttacccacagagaagcgagctgtcggagataat
gtaacagtacggtcacggacaagccggcagaagatgagcactttgttcccccggatgacc
tcgttgcatctcggcttcatctgcctggcgctgtgctcgctgcttcaggcggtaaccggc
gggtcgggccagtgcaagctcaacttccaggagtaccagaaccgacggcgctcggccatc
caggcccagatcttgagcaagctgggcctgacggcgcctcccacggacatcggccccgat
gaggtgcccgaggacgtgctagccatatacaatgagacggtacggattctggacgaacga
cgagagatgatggagtccgtctgtcagcaagctcagacagaagagtatttcgccaaggtg
cccaaagtttaccaggttgacaagaaggaccacggaggcatttacaactaccaaacaatg
aaggagcagcagtcggagttcttccgctttgacatgaggtcttacgtctccgaagtcaac
acagacgaagtctacgaggccgagctgcgactgtaccagctacctaacgccatgaagact
gagcagcagcacatcgatgtgtaccagctaataccgtcccaaagcaacggcaacccgggc
aggaagcacatctacagcacagtgcgagacaccacagatgagggctggatcaagatagac
gtcactcaagccgtcagggactgggtcagcattccagattctaatattggcatcgaggtt
acaaccccgtgcgacgacacaatccacgtcctttttgctcatccaaaaggaactatgccc
agcgttaaaatgccccaacgaggcgaccagcagatggccgatatgtcgccgcccgagcag
cacccacgcctgatcgtccttgccccggccaacgacacgataggtcccaacggtgccagt
ggccgccgaacccgtcggagtacctcaacatacggccagaacacgtgctcggaccagacg
cagcctagctgctgcctacggcagttctacgtcaactttaggcgcgacctgggctggggg
tggatacggcaaccccggggctactacccgaactactgcgccggctcctgctcgtacgtg
aatggaagcgtgtggaacgcaccgacacatcacggctcggtgctggacacgtaccggcgg
ctcaacccggacgcctccccttcgccttgctgctcgcctcggagttttaagcccctacat
atattgttttacgacaggggtagaccgatctttagagaactcccaaatgctatagtgacg
tcgtgtcagtgcagctag

DBGET integrated database retrieval system