KEGG   Acanthaster planci (crown-of-thorns starfish): 110980443Help
Entry
110980443         CDS       T05078                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aplc03110]
    110980443
Enzymes [BR:aplc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110980443
Chaperones and folding catalysts [BR:aplc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110980443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110980443
NCBI-ProteinID: XP_022092818
Position
Unknown
AA seq 188 aa AA seqDB search
MEKFYARLFVVALLLQLCFSTTVKERPIVYFDMTVDGEPLGRIIMELYSDIVPKTAENFR
ALCTGEKGFGYEGSRIHLVIPDFVIQGGDIIKGDGSGGKISIYGGVFPDENYELSHSHVG
ILTTAGRLNSNGSQFRILLTPATYFDGRSVVFGSVLFKSRGILREIERFGSYNGVPSAEI
VIAKSGQL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttttacgctcgccttttcgtcgtggcattacttctccaactgtgcttctca
acaacagtcaaagaaagaccaatagtgtatttcgatatgactgttgatggtgaaccactg
ggaaggattatcatggagctttacagcgacattgtccccaaaacagcagaaaattttcgc
gctctgtgcaccggcgagaaaggctttggctacgaagggtcaagaatccacctggtgatt
cccgactttgtcatccagggtggggacattatcaaaggcgacggaagcggaggaaagatc
agcatctatggaggggtatttcctgacgaaaactacgagttaagccacagccatgtcggt
attctgactacagctggccgattaaacagcaacggctcacagttccgcattcttcttaca
ccagcgacatatttcgatggacgaagcgttgtattcggcagcgtccttttcaagagtcgc
ggaatactcagagagatcgaaaggtttggctcatataacggggtcccctctgcagaaatt
gtaattgccaagagtggccaactgtag

DBGET integrated database retrieval system